Citrus Sinensis ID: 010559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------
MGWLTKILKGSSRRHYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEVDQKGKKVIEDDLQCIKSDDSDEDELDEDEIRAIAQQEEDERRAKAQQEEDERRARARAQLEEDEQLAKAIQDSLRVDSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ
ccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEcccccccHHHHHHHcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEcccccEEccccccccccccccccHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHcccccccccccccccEEEcEEEEEEEEEcccccccccEEEEEccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcc
ccHHHHHHccccccEEccccccccccccccccccccccccccccHHHHHHHHHcHHHHccccccccccccccccccccccccccHHHHHHHHHHHcHHccccHHcccccccccccccccHHHHHHccHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEHccccccccccEEccccccccHHHHHHHccccccccccccccccHHHHcccccccccccccccccccccccccccHccccccccEEEcccccEEEHHHHcccccccHccHHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHcccccccccccccEEEcccEEEEEEEcccccccccEEEEEcccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHcc
mgwltkilkgssrrhyharygddrtwderrysaaddssgfdneEIDRAIALSLVEVDQKGKKVIEDdlqciksddsdedeldEDEIRAIAQQEEDERRAKAQQEEDERRARARAQLEEDEQLAKAIQDslrvdsppryesgnifqpfpffsgyricagcnteighgrYLSCmeafwhpecfrchscnlpitdvefsmsgnrpyhkhcykeqhhpkcdvcqnfiptnsaglieyrahpfwlqkycpsherdgtprccscermeprdtkylsldDGRKLCLECLDsaimdthecqPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAmegeknghhhlpetrglclseeqTVTTVlrrprigagyRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRlkgypnlrpdvEEGICQVLAHMWLESeiysgsgsdvassssssasssssspsssstsskkgkrsdFEKDLGKFFKHqiesdtssaygdglgkvvrq
mgwltkilkgssrrhyharygddrtwderrysaaddssgfdneEIDRAIALSLvevdqkgkkvieddlqciksddsdedeldeDEIRAIAQQEEDERRAKAQQEEDERRARARAQLEEDEQLAKAIQDSLRVDSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCScermeprdtkylsldDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTvlrrprigagyrliDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSsssasssssspsssstsskkgkrsdFEKDLGKFFkhqiesdtssaygdglgkvvrq
MGWLTKILKGSSRRHYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEVDQKGKKVIEDDLQCIKsddsdedeldedeIRAIAQQEEDerrakaqqeederrararaqleedeqLAKAIQDSLRVDSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYsgsgsdvassssssasssssspsssstssKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ
*******************Y*************************DRAIALSLVEVDQK**KVI****************************************************************************GNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQAL****************TRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIY*******************************************************************
MGWLTKIL***********************************EIDRAIALSLV*****************************************************************************************FQ*FPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLL**********************TRGLCLSEEQT************GYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESE****************************************KDLGKFFKHQIESDTSSAYGDGLGKV***
MGWLTKILKGSSRRHYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEVDQKGKKVIEDDLQCIKSD*********DEIRAIAQQ************************EEDEQLAKAIQDSLRVDSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIY************************************FEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ
*GWLTKILKGSSRRHYHARYG**************DSS*FDNEEIDRAIALSLVEVD***************************************************************************DSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIY**********************************SDFEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWLTKILKGSSRRHYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEVDQKGKKVIEDDLQCIKSDDSDEDELDEDEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRVDSPPRYESGNIFQPFPFFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query507 2.2.26 [Sep-21-2011]
Q8W4F0553 Protein DA1-related 1 OS= yes no 0.964 0.884 0.697 0.0
P0C7Q8532 Protein DA1 OS=Arabidopsi no no 0.932 0.889 0.544 1e-159
Q0WSN2528 Protein DA1-related 2 OS= no no 0.804 0.772 0.572 1e-136
Q9FJX9560 Protein DA1-related 7 OS= no no 0.873 0.791 0.466 1e-106
Q9FJX8644 Protein DA1-related 6 OS= no no 0.854 0.672 0.453 1e-103
Q9FKN71613 Protein DA1-related 4 OS= no no 0.670 0.210 0.532 4e-95
Q84WJ0702 Protein DA1-related 5 OS= no no 0.658 0.475 0.498 7e-90
Q9LVR6450 Protein DA1-related 3 OS= no no 0.802 0.904 0.445 4e-87
P53776390 LIM/homeobox protein Lhx4 yes no 0.232 0.302 0.276 3e-07
Q969G2390 LIM/homeobox protein Lhx4 yes no 0.232 0.302 0.276 3e-07
>sp|Q8W4F0|DAR1_ARATH Protein DA1-related 1 OS=Arabidopsis thaliana GN=DAR1 PE=2 SV=3 Back     alignment and function desciption
 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/539 (69%), Positives = 422/539 (78%), Gaps = 50/539 (9%)

Query: 1   MGWLTKILKGSSRR----HYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEV 56
           MGWLTKILKGSS +      + RY +DR  +  RYSA  + S FD EEI+ AIALSL E 
Sbjct: 1   MGWLTKILKGSSHKFSDGQCNGRYREDRNLEGPRYSA--EGSDFDKEEIECAIALSLSEQ 58

Query: 57  ------DQKGKKVIEDDLQC------------------IKSDDSDEDELDEDEIRAIA-- 90
                 D KGKK+IE   +                   +++ + +E  + + +I      
Sbjct: 59  EHVIPQDDKGKKIIEYKSETEEDDDDDEDEDEEYMRAQLEAAEEEERRVAQAQIEEEEKR 118

Query: 91  ----QQEEDERR-AKAQQEEDERRARARAQLEEDEQLAKAIQDSLRVDSPPRYESGNIFQ 145
               Q EE E+  AKA+ EE+E R R++AQLEEDE LAKA+Q+S+ V SPPRY+ GNI Q
Sbjct: 119 RAEAQLEETEKLLAKARLEEEEMR-RSKAQLEEDELLAKALQESMNVGSPPRYDPGNILQ 177

Query: 146 PFPFF--SGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPY 203
           P+PF   S +RIC GC  EIGHGR+LSCM   WHPECF C++C+ PI D EFSMSGNRPY
Sbjct: 178 PYPFLIPSSHRICVGCQAEIGHGRFLSCMGGVWHPECFCCNACDKPIIDYEFSMSGNRPY 237

Query: 204 HKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEP 263
           HK CYKEQHHPKCDVC NFIPTN AGLIEYRAHPFW+QKYCPSHERDGTPRCCSCERMEP
Sbjct: 238 HKLCYKEQHHPKCDVCHNFIPTNPAGLIEYRAHPFWMQKYCPSHERDGTPRCCSCERMEP 297

Query: 264 RDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQA 323
           +DTKYL LDDGRKLCLECLDSAIMDTHECQPLYLEI+EFYEGL+MKVEQQ+P+LLVER A
Sbjct: 298 KDTKYLILDDGRKLCLECLDSAIMDTHECQPLYLEIREFYEGLHMKVEQQIPMLLVERSA 357

Query: 324 LNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEV 383
           LNEAMEGEK+GHHHLPETRGLCLSEEQTVTTVLRRPRIGAGY+LIDMITEP RLIRRCEV
Sbjct: 358 LNEAMEGEKHGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYKLIDMITEPCRLIRRCEV 417

Query: 384 TAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGS 443
           TAILILYGLPRLLTGSILAHEMMHAWLRL GYPNLRP+VEEGICQVLAHMWLESE Y+GS
Sbjct: 418 TAILILYGLPRLLTGSILAHEMMHAWLRLNGYPNLRPEVEEGICQVLAHMWLESETYAGS 477

Query: 444 G-SDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGL 501
              D+ASSSSS         +  S SSKKG+RSDFEK LG+FFKHQIESD+SSAYGDG 
Sbjct: 478 TLVDIASSSSS---------AVVSASSKKGERSDFEKKLGEFFKHQIESDSSSAYGDGF 527
Ubiquitin receptor that probably regulates developmental process.
Arabidopsis thaliana (taxid: 3702)
>sp|P0C7Q8|DA1_ARATH Protein DA1 OS=Arabidopsis thaliana GN=DA1 PE=1 SV=1 Back     alignment and function description
>sp|Q0WSN2|DAR2_ARATH Protein DA1-related 2 OS=Arabidopsis thaliana GN=DAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJX9|DAR7_ARATH Protein DA1-related 7 OS=Arabidopsis thaliana GN=DAR7 PE=2 SV=2 Back     alignment and function description
>sp|Q9FJX8|DAR6_ARATH Protein DA1-related 6 OS=Arabidopsis thaliana GN=DAR6 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q84WJ0|DAR5_ARATH Protein DA1-related 5 OS=Arabidopsis thaliana GN=DAR5 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVR6|DAR3_ARATH Protein DA1-related 3 OS=Arabidopsis thaliana GN=DAR3 PE=2 SV=2 Back     alignment and function description
>sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 Back     alignment and function description
>sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query507
356537914563 PREDICTED: protein DA1-related 1-like is 0.978 0.880 0.728 0.0
356496814546 PREDICTED: protein DA1-related 1-like is 0.976 0.906 0.742 0.0
356496816528 PREDICTED: protein DA1-related 1-like is 0.960 0.922 0.747 0.0
356537916530 PREDICTED: protein DA1-related 1-like is 0.976 0.933 0.754 0.0
297798208558 hypothetical protein ARALYDRAFT_328082 [ 0.974 0.885 0.723 0.0
255585154525 zinc ion binding protein, putative [Rici 0.976 0.942 0.781 0.0
356502199531 PREDICTED: protein DA1-related 1-like [G 0.968 0.924 0.743 0.0
357518461531 Disease resistance-like protein [Medicag 0.976 0.932 0.751 0.0
356561263532 PREDICTED: LOW QUALITY PROTEIN: protein 0.982 0.936 0.742 0.0
240256211553 LIM domain-containing protein [Arabidops 0.964 0.884 0.697 0.0
>gi|356537914|ref|XP_003537451.1| PREDICTED: protein DA1-related 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/541 (72%), Positives = 437/541 (80%), Gaps = 45/541 (8%)

Query: 1   MGWLTKILKGSS----RRHYHARYGDDRTWDERRYSAADDSSGFDNEEIDRAIALSLVEV 56
           MGW TK+LKGS     R  YH +YG+DR WD   +S+ DD +  + E+IDRAIALSL E 
Sbjct: 1   MGWFTKLLKGSDHKILRGQYHGKYGEDRIWD-NHHSSMDDLTDIEKEDIDRAIALSLSEE 59

Query: 57  DQKGKKVIEDDLQCIKSDDSDEDE------LDEDEIRAIAQQEEDERRAKAQQE------ 104
           D KGKKV++++L   K DD +EDE      LDEDE  A  QQEE+ER AK QQE      
Sbjct: 60  DHKGKKVVDEEL--CKIDDDEEDEHLVKVHLDEDERLAKIQQEEEERLAKIQQEDEHLAK 117

Query: 105 ----EDERRAR------------------ARAQLEEDEQLAKAIQDSLRVDSPPRYESGN 142
               E+ER A+                  A+AQLEEDEQLA+AIQ+SL++ SPP+Y++G+
Sbjct: 118 IQQEEEERLAKIQQEDECLAKIQQEDERLAKAQLEEDEQLARAIQESLKIGSPPQYDNGS 177

Query: 143 IFQPFP--FFSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGN 200
               FP  F  GYRICAGC TEIG GR+LSCM   WHPECF CH+C+LPITD EFSMS N
Sbjct: 178 SILSFPHLFPPGYRICAGCKTEIGQGRFLSCMGGVWHPECFCCHACHLPITDYEFSMSSN 237

Query: 201 RPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCER 260
           RPYHK CY+E+HHP+CDVC+NFIPTNS+GLIEYRAHPFWLQKYCPSHE DGT RCCSCER
Sbjct: 238 RPYHKSCYREKHHPRCDVCKNFIPTNSSGLIEYRAHPFWLQKYCPSHELDGTSRCCSCER 297

Query: 261 MEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVE 320
           MEPRDTKYL LDDGRKLCLECLDS+IMDTHECQPLYLEIQEFYEGLNMK+EQQ+P+LLVE
Sbjct: 298 MEPRDTKYLLLDDGRKLCLECLDSSIMDTHECQPLYLEIQEFYEGLNMKLEQQIPMLLVE 357

Query: 321 RQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRR 380
           RQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTT+ RRPRI AGYR IDMITEPYRLIR 
Sbjct: 358 RQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTISRRPRIAAGYRAIDMITEPYRLIRC 417

Query: 381 CEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIY 440
           CEVTAIL+LYGLPRLLTGSILAHEMMHAWLRLKGYPNL P+VEEGICQVLAHMWLESE+Y
Sbjct: 418 CEVTAILVLYGLPRLLTGSILAHEMMHAWLRLKGYPNLSPEVEEGICQVLAHMWLESELY 477

Query: 441 SGSGSDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDG 500
           SG G+D ASSS+SS SSSS S SS ST  KKGKRSDFEK LG FFKHQIESDTSSAYGDG
Sbjct: 478 SGFGNDGASSSTSSLSSSSPSSSSVST--KKGKRSDFEKKLGDFFKHQIESDTSSAYGDG 535

Query: 501 L 501
            
Sbjct: 536 F 536

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356496814|ref|XP_003517260.1| PREDICTED: protein DA1-related 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356496816|ref|XP_003517261.1| PREDICTED: protein DA1-related 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356537916|ref|XP_003537452.1| PREDICTED: protein DA1-related 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|297798208|ref|XP_002866988.1| hypothetical protein ARALYDRAFT_328082 [Arabidopsis lyrata subsp. lyrata] gi|297312824|gb|EFH43247.1| hypothetical protein ARALYDRAFT_328082 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255585154|ref|XP_002533282.1| zinc ion binding protein, putative [Ricinus communis] gi|223526907|gb|EEF29114.1| zinc ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356502199|ref|XP_003519908.1| PREDICTED: protein DA1-related 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357518461|ref|XP_003629519.1| Disease resistance-like protein [Medicago truncatula] gi|355523541|gb|AET03995.1| Disease resistance-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356561263|ref|XP_003548902.1| PREDICTED: LOW QUALITY PROTEIN: protein DA1-related 1-like [Glycine max] Back     alignment and taxonomy information
>gi|240256211|ref|NP_195404.6| LIM domain-containing protein [Arabidopsis thaliana] gi|334302915|sp|Q8W4F0.3|DAR1_ARATH RecName: Full=Protein DA1-related 1 gi|332661310|gb|AEE86710.1| LIM domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query507
TAIR|locus:2115290553 AT4G36860 [Arabidopsis thalian 0.731 0.670 0.795 4.7e-185
TAIR|locus:2202175532 DA1 "DA1" [Arabidopsis thalian 0.692 0.659 0.671 6.9e-145
TAIR|locus:2063932528 DAR2 "DA1-related protein 2" [ 0.692 0.664 0.620 3.7e-131
TAIR|locus:2154880644 DAR6 "DA1-related protein 6" [ 0.723 0.569 0.469 4.3e-94
TAIR|locus:21703381613 DAR4 "DA1-related protein 4" [ 0.670 0.210 0.507 2.9e-89
TAIR|locus:2154890702 DAR5 "DA1-related protein 5" [ 0.658 0.475 0.478 2.4e-85
WB|WBGene00012379192 Y1A5A.1 [Caenorhabditis elegan 0.254 0.671 0.305 5.2e-10
UNIPROTKB|F6QGM2214 LHX3 "LIM/homeobox protein Lhx 0.238 0.565 0.270 7.6e-08
UNIPROTKB|F1PCI5395 LHX4 "Uncharacterized protein" 0.252 0.324 0.274 1.6e-07
UNIPROTKB|F1MFM7390 LHX4 "Uncharacterized protein" 0.232 0.302 0.276 2.7e-07
TAIR|locus:2115290 AT4G36860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1665 (591.2 bits), Expect = 4.7e-185, Sum P(2) = 4.7e-185
 Identities = 303/381 (79%), Positives = 325/381 (85%)

Query:   122 LAKAIQDSLRVDSPPRYESGNIFQPFPFF--SGYRICAGCNTEIGHGRYLSCMEAFWHPE 179
             LAKA+Q+S+ V SPPRY+ GNI QP+PF   S +RIC GC  EIGHGR+LSCM   WHPE
Sbjct:   154 LAKALQESMNVGSPPRYDPGNILQPYPFLIPSSHRICVGCQAEIGHGRFLSCMGGVWHPE 213

Query:   180 CFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFW 239
             CF C++C+ PI D EFSMSGNRPYHK CYKEQHHPKCDVC NFIPTN AGLIEYRAHPFW
Sbjct:   214 CFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHNFIPTNPAGLIEYRAHPFW 273

Query:   240 LQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEI 299
             +QKYCPSHERDGTPRCCSCERMEP+DTKYL LDDGRKLCLECLDSAIMDTHECQPLYLEI
Sbjct:   274 MQKYCPSHERDGTPRCCSCERMEPKDTKYLILDDGRKLCLECLDSAIMDTHECQPLYLEI 333

Query:   300 QEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRP 359
             +EFYEGL+MKVEQQ+P+LLVER ALNEAMEGEK+GHHHLPETRGLCLSEEQTVTTVLRRP
Sbjct:   334 REFYEGLHMKVEQQIPMLLVERSALNEAMEGEKHGHHHLPETRGLCLSEEQTVTTVLRRP 393

Query:   360 RIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLR 419
             RIGAGY+LIDMITEP RLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRL GYPNLR
Sbjct:   394 RIGAGYKLIDMITEPCRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLNGYPNLR 453

Query:   420 PDVEEGICQVLAHMWLESEIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKGKRSDFEK 479
             P+VEEGICQVLAHMWLESE Y                             KKG+RSDFEK
Sbjct:   454 PEVEEGICQVLAHMWLESETYAGSTLVDIASSSSSAVVSASS--------KKGERSDFEK 505

Query:   480 DLGKFFKHQIESDTSSAYGDG 500
              LG+FFKHQIESD+SSAYGDG
Sbjct:   506 KLGEFFKHQIESDSSSAYGDG 526
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2202175 DA1 "DA1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063932 DAR2 "DA1-related protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154880 DAR6 "DA1-related protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170338 DAR4 "DA1-related protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154890 DAR5 "DA1-related protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00012379 Y1A5A.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F6QGM2 LHX3 "LIM/homeobox protein Lhx3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCI5 LHX4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFM7 LHX4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W4F0DAR1_ARATHNo assigned EC number0.69750.96440.8842yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh1_pm.C_scaffold_7000309
annotation not avaliable (558 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
pfam12315212 pfam12315, DUF3633, Protein of unknown function (D 1e-126
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 2e-28
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 5e-13
pfam0041258 pfam00412, LIM, LIM domain 2e-09
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 3e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 3e-09
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 1e-07
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 2e-07
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 2e-07
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 4e-07
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 1e-06
cd0945452 cd09454, LIM1_ZASP_Cypher, The first LIM domain of 3e-06
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 6e-06
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 1e-05
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 4e-05
cd0946852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 7e-05
cd0939758 cd09397, LIM1_UF1, LIM domain in proteins of unkno 1e-04
cd0933952 cd09339, LIM4_Paxillin_like, The fourth LIM domain 1e-04
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 1e-04
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 1e-04
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 2e-04
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 2e-04
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 2e-04
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 2e-04
cd0943456 cd09434, LIM4_FHL3, The fourth LIM domain of Four 2e-04
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 2e-04
cd0944753 cd09447, LIM_LASP, The LIM domain of LIM and SH3 P 2e-04
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 3e-04
cd0939455 cd09394, LIM1_Rga, The first LIM domain of Rga GTP 3e-04
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 3e-04
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 4e-04
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 4e-04
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 5e-04
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 5e-04
cd0945554 cd09455, LIM1_Enigma_like_1, The first LIM domain 5e-04
cd0946755 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b 6e-04
cd0941252 cd09412, LIM4_Leupaxin, The fourth LIM domain of L 7e-04
cd0943052 cd09430, LIM5_LIMPETin, The fifth LIM domain of pr 7e-04
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 8e-04
cd0936852 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L 9e-04
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 9e-04
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 0.001
cd0938655 cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( 0.001
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 0.001
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 0.001
COG0330291 COG0330, HflC, Membrane protease subunits, stomati 0.002
cd0943358 cd09433, LIM4_FHL2, The fourth LIM domain of Four 0.002
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 0.002
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 0.002
cd0946455 cd09464, LIM2_LIMK1, The second LIM domain of LIMK 0.002
PRK07353140 PRK07353, PRK07353, F0F1 ATP synthase subunit B'; 0.003
cd0938855 cd09388, LIM1_LMO1_LMO3, The first LIM domain of L 0.003
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
cd0939553 cd09395, LIM2_Rga, The second LIM domain of Rga GT 0.004
cd0933554 cd09335, LIM5_PINCH, The fifth LIM domain of prote 0.004
cd0941152 cd09411, LIM4_Paxillin, The fourth LIM domain of P 0.004
>gnl|CDD|204878 pfam12315, DUF3633, Protein of unknown function (DUF3633) Back     alignment and domain information 
 Score =  367 bits (943), Expect = e-126
 Identities = 147/200 (73%), Positives = 168/200 (84%), Gaps = 8/200 (4%)

Query: 305 GLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAG 364
           GLNMK+EQ++P+LLVERQALN+A EGEK GHHH PETRGLCLSEEQ VT+VL+RPRIG G
Sbjct: 1   GLNMKIEQEIPMLLVERQALNKAREGEKIGHHHTPETRGLCLSEEQIVTSVLKRPRIGPG 60

Query: 365 YRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEE 424
            RLI M TEP +L RRCEVTAIL+LYGLPRLLTGSILAHEMMHAWLRL GY NL P+VEE
Sbjct: 61  NRLIGMGTEPQKLTRRCEVTAILVLYGLPRLLTGSILAHEMMHAWLRLNGYRNLNPEVEE 120

Query: 425 GICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKF 484
           GICQVL HMWLESE Y        +SSS+S+SSSSSS S +++SSKKG++SDFEK LG+F
Sbjct: 121 GICQVLGHMWLESETY--------ASSSASSSSSSSSSSPAASSSKKGEKSDFEKKLGEF 172

Query: 485 FKHQIESDTSSAYGDGLGKV 504
           FKHQIE+D+S  YGDG    
Sbjct: 173 FKHQIETDSSPVYGDGFRAA 192

This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with pfam00412. Length = 212
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of Rga GTPase-Activating Proteins Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|188817 cd09433, LIM4_FHL2, The fourth LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|235999 PRK07353, PRK07353, F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|188781 cd09395, LIM2_Rga, The second LIM domain of Rga GTPase-Activating Proteins Back     alignment and domain information
>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 507
PF12315212 DUF3633: Protein of unknown function (DUF3633); In 100.0
KOG2272332 consensus Focal adhesion protein PINCH-1, contains 99.9
KOG1703479 consensus Adaptor protein Enigma and related PDZ-L 99.9
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 99.83
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.8
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 99.76
KOG2272332 consensus Focal adhesion protein PINCH-1, contains 99.64
KOG1044 670 consensus Actin-binding LIM Zn-finger protein Lima 99.57
KOG1703479 consensus Adaptor protein Enigma and related PDZ-L 99.51
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.23
KOG1044 670 consensus Actin-binding LIM Zn-finger protein Lima 99.08
KOG1700200 consensus Regulatory protein MLP and related LIM p 98.63
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 98.43
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.26
KOG4577383 consensus Transcription factor LIM3, contains LIM 97.63
KOG1702264 consensus Nebulin repeat protein [Cytoskeleton] 97.44
KOG1700200 consensus Regulatory protein MLP and related LIM p 97.15
KOG0490235 consensus Transcription factor, contains HOX domai 97.0
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 96.86
PF13485128 Peptidase_MA_2: Peptidase MA superfamily 93.74
smart0072626 UIM Ubiquitin-interacting motif. Present in protea 87.87
PF0280918 UIM: Ubiquitin interaction motif; InterPro: IPR003 83.79
>PF12315 DUF3633: Protein of unknown function (DUF3633); InterPro: IPR022087 This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length Back     alignment and domain information 
Probab=100.00  E-value=2.2e-69  Score=512.51  Aligned_cols=194  Identities=78%  Similarity=1.208  Sum_probs=183.1

Q ss_pred             hcCCccccccceEEEehhhhHHhhccCCCCccccccccCcccCccchhcccccccccCCCCeeeeeccccccccccceee
Q 010559          305 GLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVT  384 (507)
Q Consensus       305 ~l~~~i~~~iPv~LVe~~aLn~a~e~e~~g~~~~~e~rGlclSee~~v~~~~~~~~~~~G~rilei~~~p~~~~~~~eV~  384 (507)
                      +|||+++++|||+||+++|||+|.+.|++|++|.++||||||||+|+|++|.++|++++|+++++|.++|+++++.|+|+
T Consensus         1 ~lnmki~q~~PllLVe~~aLN~a~~~Ek~~~~~~~~tRGLclseeq~v~sv~~~p~~~~~~~~~~~~~e~~~~~~~~eV~   80 (212)
T PF12315_consen    1 GLNMKIEQEIPLLLVERQALNEAEEGEKIGHHHMPETRGLCLSEEQTVTSVLRRPRMGPGNQLIDMSTEPQRLTRGCEVT   80 (212)
T ss_pred             CCCCcccCCCCeEEecHHHHHHHHhhccCCCCCCeeeeeeeeeeeEEEEEEEecCCcCCCCccceeeecceeeccceeEE
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeecCchhhhhhhhhhcchhhHHHHhcCCCCCCCcchhhHHHHHHHHHhhcccccCCCCCccCCCCCCCCCCCCCCCC
Q 010559          385 AILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSS  464 (507)
Q Consensus       385 ~Il~l~glP~~L~gsilaHE~~Hawl~~~g~~~L~~~~eEG~cq~~a~~wl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  464 (507)
                      +|+|||||||+|||||||||+||||||++|||+|+|+||||||||||||||++|++++.+        +++++|++++++
T Consensus        81 ~Ilvl~GLPrll~gsiLAHE~mHa~Lrl~g~~~L~~~vEEGiCqvla~~wL~~~~~~~~~--------~~~~~s~~~s~~  152 (212)
T PF12315_consen   81 AILVLYGLPRLLTGSILAHELMHAWLRLNGFPNLSPEVEEGICQVLAYLWLESELASGSG--------SSSSSSSSSSSS  152 (212)
T ss_pred             EEEEECCCCHHHHhhHHHHHHHHHHhcccCCCCCChHHHHHHHHHHHHHHHhhhhhcccC--------CcccccCCCCCC
Confidence            999999999999999999999999999999999999999999999999999999998765        112345556677


Q ss_pred             CCcCCcCCCcchHHHHHHHHHHhhhhcCCCCCCchhhhhhhc
Q 010559          465 SSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVR  506 (507)
Q Consensus       465 ~~~~~~~~~~~~~~~~l~~~~~~qi~~d~s~~yG~Gfr~~~~  506 (507)
                      +++++|||++++||+||++||+|||++|+|||||||||+|++
T Consensus       153 ~~~~skkg~~s~~E~kL~~f~~~qIe~D~SpvYGdGFRaa~~  194 (212)
T PF12315_consen  153 ASSSSKKGAKSQFEKKLGEFFKHQIETDTSPVYGDGFRAANE  194 (212)
T ss_pred             cccccccccccHHHHHHHHHHHHHhccCCCcccchHHHHHHH
Confidence            778899999999999999999999999999999999999985

The family is found in association with PF00412 from PFAM.
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton] Back     alignment and domain information
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>PF13485 Peptidase_MA_2: Peptidase MA superfamily Back     alignment and domain information
>smart00726 UIM Ubiquitin-interacting motif Back     alignment and domain information
>PF02809 UIM: Ubiquitin interaction motif; InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 9e-07
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 4e-06
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 3e-05
1x3h_A80 Solution Structure Of The Lim Domain Of Human Leupa 1e-04
2cup_A101 Solution Structure Of The Skeletal Muscle Lim-Prote 3e-04
2dj7_A80 Solution Structure Of 3rd Lim Domain Of Actin-Bindi 4e-04
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 12/130 (9%)
Query: 156 CAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPK 215
           CAGCN  I     L  ++  WH  C +C  C + + D  FS +G+  Y K  + ++   K
Sbjct: 9   CAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSV-YCKEDFFKRFGTK 67
Query: 216 CDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGR 275
           C  CQ  IP      +  +A  F    +C +        C  C R      ++  ++DGR
Sbjct: 68  CTACQQGIPPTQ---VVRKAQDFVYHLHCFA--------CIICNRQLATGDEFYLMEDGR 116
Query: 276 KLCLECLDSA 285
            +C E  ++A
Sbjct: 117 LVCKEDYETA 126
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 Back     alignment and structure
>pdb|2CUP|A Chain A, Solution Structure Of The Skeletal Muscle Lim-Protein 1 Length = 101 Back     alignment and structure
>pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 8e-23
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 9e-23
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-22
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-21
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-21
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 4e-20
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-20
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-19
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-19
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-08
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-18
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-17
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-17
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-17
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 4e-17
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 5e-17
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 8e-16
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-04
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 6e-17
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-11
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-16
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-04
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 1e-16
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-16
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 8e-16
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 8e-16
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-15
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-15
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 2e-15
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-15
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 4e-15
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-13
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-14
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 2e-14
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 3e-14
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 4e-14
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 5e-14
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-10
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-13
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 2e-13
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 3e-13
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 5e-13
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 6e-13
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 5e-04
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-12
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 8e-12
2cor_A79 Pinch protein; LIM domain, particularly interestin 9e-10
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
2co8_A82 NEDD9 interacting protein with calponin homology a 8e-06
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 7e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
 Score = 90.9 bits (226), Expect = 8e-23
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 1/66 (1%)

Query: 151 SGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKE 210
           SG   C  CN  I     ++  +  WH +CF C +C+  +    F+   ++ Y   CYK 
Sbjct: 3   SGSSGCVKCNKAIT-SGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKN 61

Query: 211 QHHPKC 216
                 
Sbjct: 62  FVSGPS 67
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query507
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.9
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.9
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.89
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.89
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.87
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.87
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.82
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.73
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.66
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.58
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.58
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.58
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.58
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.55
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.54
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.54
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.53
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.53
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.51
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.51
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.5
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.49
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.49
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.48
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.48
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.48
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.47
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.46
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.46
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.45
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.43
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.43
2co8_A82 NEDD9 interacting protein with calponin homology a 99.42
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.41
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.39
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.38
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.38
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.38
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.37
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.37
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.35
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.34
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.34
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.32
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.31
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.3
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.28
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.28
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.25
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.24
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.17
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.03
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 98.99
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 98.94
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 98.92
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 98.83
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 98.83
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.8
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 98.79
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 98.78
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 98.78
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 98.78
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 98.77
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 98.76
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.73
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.72
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 98.72
3f6q_B72 LIM and senescent cell antigen-like-containing dom 98.67
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 98.66
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 98.66
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 98.65
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 98.65
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 98.64
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 98.63
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 98.63
2cor_A79 Pinch protein; LIM domain, particularly interestin 98.6
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 98.57
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 98.56
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.54
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 98.53
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.5
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 98.5
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 98.43
2co8_A82 NEDD9 interacting protein with calponin homology a 98.41
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.29
2d3g_P26 Ubiquitin interacting motif from hepatocyte growth 92.6
1q0v_A81 Hydrophilic protein; has cysteine rich putative zi 83.83
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 81.31
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
Probab=99.90  E-value=6.6e-24  Score=200.07  Aligned_cols=124  Identities=23%  Similarity=0.543  Sum_probs=108.6

Q ss_pred             CCCCCcCccCCcccccCceeeecCceeccCCcccCCCCCCCCCcceeecCCccccccccccccCccccccCCccccCccc
Q 010559          150 FSGYRICAGCNTEIGHGRYLSCMEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAG  229 (507)
Q Consensus       150 ~~g~~~C~~C~k~I~~g~~i~alg~~wHp~CF~Cs~C~~~L~~~~f~~~~gk~yCk~CY~~~f~pkC~~C~~~I~~~~~g  229 (507)
                      ....++|.+|+++|....++.++++.||+.||+|..|+++|.+..| .++|++||+.||.++|+++|.+|+++|.+.. .
T Consensus        57 ~~~~~~C~~C~~~I~~~~~~~a~~~~wH~~CF~C~~C~~~L~~~~f-~~~g~~yC~~~y~~~f~~kC~~C~~~I~~~~-~  134 (182)
T 2jtn_A           57 TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCF-SRGESVYCKDDFFKRFGTKCAACQLGIPPTQ-V  134 (182)
T ss_dssp             CCSCCBCBTSSSBCCCSEEEEETTEEECSSTTSCTTTCCCCSSCCE-EETTEEECHHHHHHTTSCCCTTTCCCCCSSC-C
T ss_pred             CCCCCcCccCCCCccCceeEEecCCeEccccCccCCCCCccCCCce-eECCEeeecCccccccccccccCCCccCCCc-e
Confidence            4567899999999986667899999999999999999999998876 5899999999999999999999999998753 2


Q ss_pred             ceeeccccccccccCCCccCCCCCccCCCCCcCCCCCceEEccCCceecccccccc
Q 010559          230 LIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSA  285 (507)
Q Consensus       230 ~i~~~~hpfw~~~yCp~h~H~~CF~C~~C~~~l~~g~~y~~l~dGr~~C~~C~~~~  285 (507)
                      ++.+.+..          ||..||+|..|++.|..|..|+...+|++||..||.++
T Consensus       135 v~~a~~~~----------~H~~CF~C~~C~~~L~~g~~f~~~~~g~~yC~~cy~~~  180 (182)
T 2jtn_A          135 VRRAQDFV----------YHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETA  180 (182)
T ss_dssp             CCEETTEE----------CCTTTCCCTTTCCCCCTTCEEEECTTSCEECHHHHHHH
T ss_pred             EEecCCCC----------EEeCCCcCCCCCCCCCCCCceEEccCCEEECHHHHHHh
Confidence            34555554          49999999999999987888888889999999999864
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} SCOP: j.105.1.1 PDB: 1q0w_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 507
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 7e-04
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 7e-04
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: PDZ and LIM domain protein 5, Enigma
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.5 bits (82), Expect = 7e-04
 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 155 ICAGCNTEIGHGRYLSCMEAFWHPECF 181
           +CA CN  I  G +L  +   WHPE F
Sbjct: 20  MCAHCNQVI-RGPFLVALGKSWHPEEF 45
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query507
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.24
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.22
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.12
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.02
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.96
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.81
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.8
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.72
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.68
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.67
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.61
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.58
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.52
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 97.47
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.37
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.33
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 97.33
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 97.31
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.23
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.16
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.13
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.07
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.05
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.03
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.01
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.0
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.99
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.99
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.93
d2co8a236 Nedd9 interacting protein with calponin homology, 96.92
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.88
d1g47a235 Pinch (particularly interesting new Cys-His) prote 96.77
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.74
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 96.68
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 96.57
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.48
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 96.47
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.46
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 96.44
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.41
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.32
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 96.27
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.26
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.23
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.13
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.06
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.02
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 95.91
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 95.88
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 95.72
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 95.71
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.36
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 95.35
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.33
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.27
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 95.15
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 95.06
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 94.94
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 94.78
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.58
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.1
d2cora131 Pinch (particularly interesting new Cys-His) prote 94.03
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 94.0
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 93.71
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 93.53
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 93.35
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 93.31
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 93.3
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 93.29
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 92.95
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 92.35
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 92.14
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 92.13
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 91.69
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 91.06
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 90.54
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 89.65
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 89.61
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 89.6
d1g47a135 Pinch (particularly interesting new Cys-His) prote 89.47
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 89.4
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 88.64
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 88.51
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 88.42
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 87.81
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 87.79
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 87.72
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 87.49
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 87.43
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 87.39
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 87.34
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 87.28
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 86.98
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 86.95
d2cora235 Pinch (particularly interesting new Cys-His) prote 86.92
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 86.87
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 86.65
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 86.42
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 86.38
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 86.37
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 85.87
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 85.65
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 85.37
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 85.28
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 85.15
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 84.86
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 84.79
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 84.74
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 84.73
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 84.36
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 84.24
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 84.18
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 84.15
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 84.1
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 83.95
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 83.92
d1rzxa_98 GTPase-binding domain of the cell polarity protein 83.51
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 83.38
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 83.09
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 83.03
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 82.59
d1y7na179 Amyloid beta A4 precursor protein-binding family A 82.26
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 81.99
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 81.7
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 81.7
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 81.66
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 81.59
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 81.46
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 81.39
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 81.36
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 81.35
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 81.2
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 80.65
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 80.61
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 80.58
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 80.32
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 80.11
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.38  E-value=9.2e-08  Score=64.68  Aligned_cols=31  Identities=45%  Similarity=0.990  Sum_probs=28.4

Q ss_pred             CCCCCcCccCCcccccCceeeecCceeccCCc
Q 010559          150 FSGYRICAGCNTEIGHGRYLSCMEAFWHPECF  181 (507)
Q Consensus       150 ~~g~~~C~~C~k~I~~g~~i~alg~~wHp~CF  181 (507)
                      ...+++|.+|+++| .|++|+|+|+.|||+||
T Consensus         5 ~~fapkC~~C~~~I-~g~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           5 AMFSPKCGGCNRPV-LENYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCSCBCTTTCCBC-CSSCEEETTEEECTTTC
T ss_pred             HHhChhhhhcCCcc-cchheeecCCccCcccC
Confidence            45678999999999 59999999999999998
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure