Citrus Sinensis ID: 010590


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAVNRHDPSIYHHHSQEF
ccHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEEEEEEcccHHHHHHHcccccccccccccccccccccccccccccccCECccccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccHHHHHHccccccccccccccc
*********LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG***********************SRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGI****SSSTATVIYPPPMSCCS*********************DSSRLVYLNLGAGTGNSAHHHHH**G*****GD*DSS***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAVNRHDPSIYHHHSQEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulatory protein NPR5 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Acts redundantly with BOP2. BOP1/2 promote leaf and floral meristem fate and determinacy in a pathway targeting AP1 and AGL24. BOP1/2 act as transcriptional co-regulators through direct interaction with TGA factors, including PAN, a direct regulator of AP1. Controls lateral organ fate through positive regulation of adaxial-abaxial polarity genes ATHB-14/PHB, YAB1/FIL and YAB3, and through positive regulation of LOB domain-containing genes LOB, LBD6/AS2 and LBD36. Promotes and maintains a developmentally determinate state in leaf cells through the negative regulation of JAG, JGL and class I KNOX genes. Is also involved in nectary development, formation of normal abscission zones and suppression of bract formation.confidentQ9ZVC2
Regulatory protein NPR6 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Acts redundantly with BOP2. BOP1/2 promote leaf and floral meristem fate and determinacy in a pathway targeting AP1 and AGL24. BOP1/2 act as transcriptional co-regulators through direct interaction with TGA factors, including PAN, a direct regulator of AP1. Controls lateral organ fate through positive regulation of adaxial-abaxial polarity genes ATHB-14/PHB, YAB1/FIL and YAB3, and through positive regulation of LOB domain-containing genes LOB, LBD6/AS2 and LBD36. Promotes and maintains a developmentally determinate state in leaf cells through the negative regulation of JAG, JGL and class I KNOX genes. Is also involved in nectary development, formation of normal abscission zones and suppression of bract formation.probableQ9M1I7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 251-425,437-473
View the alignment between query and template
View the model in PyMOL
Template: 3UTM, chain A
Confidence level:very confident
Coverage over the Query: 214-400,412-426,438-473
View the alignment between query and template
View the model in PyMOL
Template: 2PNN, chain A
Confidence level:very confident
Coverage over the Query: 254-362,381-400,412-487
View the alignment between query and template
View the model in PyMOL
Template: 3HTM, chain A
Confidence level:very confident
Coverage over the Query: 6-61,82-114,138-199
View the alignment between query and template
View the model in PyMOL
Template: 3V7D, chain A
Confidence level:probable
Coverage over the Query: 26-56,84-178
View the alignment between query and template
View the model in PyMOL