Citrus Sinensis ID: 010590


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAVNRHDPSIYHHHSQEF
ccHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEEEEEEcccHHHHHHHcccccccccccccccccccccccccccccccEEEccccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccc
ccHHHHHHHHcHHHHHHHHccccccEEEEEEcccEEcHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHccccHHHcccccccHHcHHHEEEcccccHHHcHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHccccccccccccccc
MTLEESLRSLSLDYLNLLIngqafsdvtfsvEGRLVHAHRCILAARSLFFRkffcgpdppsgldpatasrinqgppspasrptgvipvnsVGYEVFLLLLQFLYsgqvsivpqkheprpncgergcwhthcTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHlvaksglppevlakhlpiEVVAKIEDLRHKSSLARrslishhhhhhhhdlsaaaaADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGaadvnypagpagktplhiAAEMVSPDMVAVLLDhhadpnvrtvdgvtpldILRTLTsdflfkgavpglthiepnKLRLCLELVQSAALVLSReegilnepssstatviypppmsccseevhnnsssgsatinnnslnldssRLVYLNLgagtgnsahhhhhqmgssrmdgdddsshqsqreavnrhdpsiyhhhsqef
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSReegilnepssstatviYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDDDSSHQSQReavnrhdpsiYHHHSQEF
MTLEEslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSavdlaldtlaaaRYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKsslarrslishhhhhhhhdlsaaaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATInnnslnldssrlVYLNLGAGTGNSAHHHHHQmgssrmdgdddssHQSQREAVNRHDPSIYHHHSQEF
*********LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG***************************GVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIE*************************************************VELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGI***********I**********************************LVYLNL**************************************************
**********SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG***********************SRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAL************SSSTATVIYPPPMSCCS*********************DSSRLVYLNLGAGTGNSAHHHHHQMG*S***GD*DSS***********************
********SLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRI*********RPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSL*************AAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCS***********ATINNNSLNLDSSRLVYLNLGAGTG******************************NRHDPSI********
****ESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP*********************ASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPP***********************LNLDSSRLVYLNLGAGTGNSAHHHHH**GS**MDGDDDSSHQS*****NRHDP**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAVNRHDPSIYHHHSQEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query506 2.2.26 [Sep-21-2011]
Q9ZVC2491 Regulatory protein NPR5 O yes no 0.930 0.959 0.779 0.0
Q9M1I7467 Regulatory protein NPR6 O no no 0.889 0.963 0.741 0.0
Q5ICL9574 Regulatory protein NPR4 O no no 0.679 0.599 0.316 7e-41
Q8L746586 Regulatory protein NPR3 O no no 0.697 0.602 0.320 8e-40
P93002593 Regulatory protein NPR1 O no no 0.658 0.561 0.298 2e-32
Q9SZI3600 Regulatory protein NPR2 O no no 0.630 0.531 0.293 6e-30
Q05823 741 2-5A-dependent ribonuclea yes no 0.156 0.106 0.425 2e-07
Q96Q07 612 BTB/POZ domain-containing no no 0.167 0.138 0.307 3e-07
Q5PQR3 612 BTB/POZ domain-containing yes no 0.298 0.246 0.246 3e-07
A4IFG2 611 BTB/POZ domain-containing yes no 0.167 0.139 0.307 3e-07
>sp|Q9ZVC2|NPR5_ARATH Regulatory protein NPR5 OS=Arabidopsis thaliana GN=NPR5 PE=1 SV=1 Back     alignment and function desciption
 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/507 (77%), Positives = 425/507 (83%), Gaps = 36/507 (7%)

Query: 3   LEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG---PDP 59
           LEESLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG   P P
Sbjct: 4   LEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDSPQP 63

Query: 60  PSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP 119
            +G+DP     +   P   ++ P G+IPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP
Sbjct: 64  VTGIDPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP 123

Query: 120 NCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIA 179
           NCGERGCWHTHC++AVDLALDTLAA+RYFGVEQLALLTQKQLA+MVEKASIEDVMKVLIA
Sbjct: 124 NCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVMKVLIA 183

Query: 180 SRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHH 239
           SRKQDMHQLWTTCSHLVAKSGLPPE+LAKHLPI+VV KIE+LR KSS+ARRSL+    H+
Sbjct: 184 SRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLMP---HN 240

Query: 240 HHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE 299
           HHHDLS   A DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSRE
Sbjct: 241 HHHDLS--VAQDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSRE 298

Query: 300 VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDI 359
           VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTV G+TPLDI
Sbjct: 299 VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLDI 358

Query: 360 LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG-ILNEPSSSTATVIYP 418
           LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAA+V+SREEG   N  ++   T IYP
Sbjct: 359 LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNQNNDNNTGIYP 418

Query: 419 PPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDG 478
                     H N    S +   ++ NLD SRLVYLNLGAGTG        QMG  R  G
Sbjct: 419 ----------HMNEEHNSGSSGGSNNNLD-SRLVYLNLGAGTG--------QMGPGRDQG 459

Query: 479 DDDSSHQSQREAVNRHDPSIYHHHSQE 505
           DD   H SQRE ++RH     HHH Q+
Sbjct: 460 DD---HNSQREGMSRH-----HHHHQD 478




May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Acts redundantly with BOP2. BOP1/2 promote leaf and floral meristem fate and determinacy in a pathway targeting AP1 and AGL24. BOP1/2 act as transcriptional co-regulators through direct interaction with TGA factors, including PAN, a direct regulator of AP1. Controls lateral organ fate through positive regulation of adaxial-abaxial polarity genes ATHB-14/PHB, YAB1/FIL and YAB3, and through positive regulation of LOB domain-containing genes LOB, LBD6/AS2 and LBD36. Promotes and maintains a developmentally determinate state in leaf cells through the negative regulation of JAG, JGL and class I KNOX genes. Is also involved in nectary development, formation of normal abscission zones and suppression of bract formation.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M1I7|NPR6_ARATH Regulatory protein NPR6 OS=Arabidopsis thaliana GN=NPR6 PE=1 SV=1 Back     alignment and function description
>sp|Q5ICL9|NPR4_ARATH Regulatory protein NPR4 OS=Arabidopsis thaliana GN=NPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q8L746|NPR3_ARATH Regulatory protein NPR3 OS=Arabidopsis thaliana GN=NPR3 PE=1 SV=1 Back     alignment and function description
>sp|P93002|NPR1_ARATH Regulatory protein NPR1 OS=Arabidopsis thaliana GN=NPR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZI3|NPR2_ARATH Regulatory protein NPR2 OS=Arabidopsis thaliana GN=NPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 Back     alignment and function description
>sp|Q96Q07|BTBD9_HUMAN BTB/POZ domain-containing protein 9 OS=Homo sapiens GN=BTBD9 PE=2 SV=2 Back     alignment and function description
>sp|Q5PQR3|BTBD9_RAT BTB/POZ domain-containing protein 9 OS=Rattus norvegicus GN=Btbd9 PE=2 SV=1 Back     alignment and function description
>sp|A4IFG2|BTBD9_BOVIN BTB/POZ domain-containing protein 9 OS=Bos taurus GN=BTBD9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
225441317490 PREDICTED: regulatory protein NPR5 [Viti 0.946 0.977 0.818 0.0
224090009481 BOP/NPR1/NIM1-like regulatory protein [P 0.944 0.993 0.840 0.0
147852378490 hypothetical protein VITISV_010389 [Viti 0.946 0.977 0.816 0.0
255581389491 aberrant large forked product, putative 0.954 0.983 0.848 0.0
356650812483 BTB/POZ ankyrin repeat protein [Pisum sa 0.932 0.977 0.791 0.0
297827775491 hypothetical protein ARALYDRAFT_903451 [ 0.944 0.973 0.775 0.0
356650816483 BTB/POZ ankyrin repeat protein [Pisum sa 0.932 0.977 0.789 0.0
356650804483 BTB/POZ ankyrin repeat protein [Medicago 0.928 0.973 0.796 0.0
15227330491 ankyrin repeat and BTB/POZ domain-contai 0.930 0.959 0.779 0.0
356498615476 PREDICTED: regulatory protein NPR5-like 0.916 0.974 0.764 0.0
>gi|225441317|ref|XP_002275980.1| PREDICTED: regulatory protein NPR5 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/517 (81%), Positives = 447/517 (86%), Gaps = 38/517 (7%)

Query: 1   MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPP 60
           MTLE+SLRSLSLDYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCGPDPP
Sbjct: 1   MTLEDSLRSLSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGPDPP 60

Query: 61  SGLDPATASRINQGPPSPASRPTG----VIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHE 116
           +GLDP   SR+     + A+ P G    VIPVNSVGYEVFLL+LQFLYSGQVSIVPQKHE
Sbjct: 61  AGLDPG-GSRMGSAAAALATSPRGGNSHVIPVNSVGYEVFLLVLQFLYSGQVSIVPQKHE 119

Query: 117 PRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKV 176
           PRPNCGERGCWHTHCTSAVDLALDTLAAAR FGVEQLALLTQKQLA+MVEKASIEDVMKV
Sbjct: 120 PRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKV 179

Query: 177 LIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHH 236
           LIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPI+VVAKIE+LR KSSLARRSL+ HH
Sbjct: 180 LIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLMPHH 239

Query: 237 HHHHHHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC 296
           HHH        AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC
Sbjct: 240 HHHQ----DIGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC 295

Query: 297 SREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTP 356
           SREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTP
Sbjct: 296 SREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTP 355

Query: 357 LDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVI 416
           LD+LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG  N PSS+T   I
Sbjct: 356 LDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGSANAPSSTT---I 412

Query: 417 YPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGA-GTGNSAHHHHHQMGSSR 475
           YPP        + ++  S S++ N  SLNLD SRLVYLNLGA G+G        QMG SR
Sbjct: 413 YPP--------MSDDHHSSSSSSNMASLNLD-SRLVYLNLGATGSG--------QMG-SR 454

Query: 476 MDGDDDSSHQSQREAVNRH------DPSIYHHHSQEF 506
           MD +DD SH +QREA+NRH      D S+Y HHS E+
Sbjct: 455 MDREDDVSHNNQREAMNRHGSQGGCDTSMY-HHSHEY 490




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224090009|ref|XP_002308905.1| BOP/NPR1/NIM1-like regulatory protein [Populus trichocarpa] gi|222854881|gb|EEE92428.1| BOP/NPR1/NIM1-like regulatory protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147852378|emb|CAN80112.1| hypothetical protein VITISV_010389 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255581389|ref|XP_002531503.1| aberrant large forked product, putative [Ricinus communis] gi|223528890|gb|EEF30890.1| aberrant large forked product, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356650812|gb|AET34790.1| BTB/POZ ankyrin repeat protein [Pisum sativum] gi|356650814|gb|AET34791.1| BTB/POZ ankyrin repeat protein [Pisum sativum] Back     alignment and taxonomy information
>gi|297827775|ref|XP_002881770.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. lyrata] gi|297327609|gb|EFH58029.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356650816|gb|AET34792.1| BTB/POZ ankyrin repeat protein [Pisum sativum] Back     alignment and taxonomy information
>gi|356650804|gb|AET34786.1| BTB/POZ ankyrin repeat protein [Medicago truncatula] gi|356650808|gb|AET34788.1| BTB/POZ ankyrin repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|15227330|ref|NP_181668.1| ankyrin repeat and BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75315939|sp|Q9ZVC2.1|NPR5_ARATH RecName: Full=Regulatory protein NPR5; AltName: Full=BTB/POZ domain-containing protein NPR5; AltName: Full=Protein BLADE ON PETIOLE 2 gi|3894187|gb|AAC78536.1| hypothetical protein [Arabidopsis thaliana] gi|53749156|gb|AAU90063.1| At2g41370 [Arabidopsis thaliana] gi|60545031|gb|AAX22759.1| BLADE-ON-PETIOLE2 [Arabidopsis thaliana] gi|330254872|gb|AEC09966.1| ankyrin repeat and BTB/POZ domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356498615|ref|XP_003518145.1| PREDICTED: regulatory protein NPR5-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
TAIR|locus:2040292491 BOP2 "BLADE ON PETIOLE2" [Arab 0.948 0.977 0.678 1.6e-173
TAIR|locus:2080595467 BOP1 "BLADE ON PETIOLE 1" [Ara 0.889 0.963 0.684 8.5e-162
TAIR|locus:2133925574 NPR4 "NPR1-like protein 4" [Ar 0.268 0.236 0.384 5.6e-31
TAIR|locus:2153192586 NPR3 "AT5G45110" [Arabidopsis 0.616 0.532 0.301 2e-29
TAIR|locus:2014200593 NPR1 "AT1G64280" [Arabidopsis 0.262 0.224 0.367 1.2e-25
TAIR|locus:2120800600 AT4G26120 "AT4G26120" [Arabido 0.266 0.225 0.385 7.5e-23
DICTYBASE|DDB_G0289189232 psmD10 "26S proteasome non-ATP 0.227 0.495 0.325 3.9e-06
RGD|621887359 Nfkbib "nuclear factor of kapp 0.154 0.217 0.417 7.8e-06
MGI|MGI:104752359 Nfkbib "nuclear factor of kapp 0.154 0.217 0.405 1e-05
UNIPROTKB|Q96DX5294 ASB9 "Ankyrin repeat and SOCS 0.237 0.408 0.310 1.1e-05
TAIR|locus:2040292 BOP2 "BLADE ON PETIOLE2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1639 (582.0 bits), Expect = 1.6e-173, Sum P(2) = 1.6e-173
 Identities = 344/507 (67%), Positives = 368/507 (72%)

Query:     3 LEEXXXXXXXXXXXXXINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG---PDP 59
             LEE             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG   P P
Sbjct:     4 LEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDSPQP 63

Query:    60 PSGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP 119
              +G+DP     +   P   ++ P G+IPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP
Sbjct:    64 VTGIDPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRP 123

Query:   120 NCGERGCWHTHCTSXXXXXXXXXXXXRYFGVEQLALLTQKQLANMVEKASIEDVMKVLIA 179
             NCGERGCWHTHC++            RYFGVEQLALLTQKQLA+MVEKASIEDVMKVLIA
Sbjct:   124 NCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVMKVLIA 183

Query:   180 SRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKXXXXXXXXXXXXXXX 239
             SRKQDMHQLWTTCSHLVAKSGLPPE+LAKHLPI+VV KIE+LR K               
Sbjct:   184 SRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLMPHNHHH 243

Query:   240 XXXXXXXXXXXXXEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE 299
                          EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSRE
Sbjct:   244 DLSVAQDL-----EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSRE 298

Query:   300 VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDI 359
             VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTV G+TPLDI
Sbjct:   299 VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLDI 358

Query:   360 LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGI-LNEPSSSTATVIYP 418
             LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAA+V+SREEG   N  ++   T IYP
Sbjct:   359 LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNQNNDNNTGIYP 418

Query:   419 PPMSCCSEEVHNNSSSGSATIXXXXXXXXXXXXVYLNLGAGTGNSAHHHHHQXXXXXXXX 478
                   +EE HN+ SSG +              VYLNLGAGTG                 
Sbjct:   419 H----MNEE-HNSGSSGGSN------NNLDSRLVYLNLGAGTGQMGPGRDQGDDHNSQRE 467

Query:   479 XXXXXHQSQREAVNRHDPS-IYHHHSQ 504
                  H       +  DPS +YHHH Q
Sbjct:   468 GMSRHHH------HHQDPSTMYHHHHQ 488


GO:0005634 "nucleus" evidence=ISM;IDA
GO:0010227 "floral organ abscission" evidence=IGI;RCA
GO:0010434 "bract formation" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009954 "proximal/distal pattern formation" evidence=IGI;RCA
GO:0048439 "flower morphogenesis" evidence=IGI;RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=IGI
GO:0010254 "nectary development" evidence=IGI
GO:0010582 "floral meristem determinacy" evidence=IGI
GO:0009864 "induced systemic resistance, jasmonic acid mediated signaling pathway" evidence=IGI
TAIR|locus:2080595 BOP1 "BLADE ON PETIOLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133925 NPR4 "NPR1-like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153192 NPR3 "AT5G45110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014200 NPR1 "AT1G64280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120800 AT4G26120 "AT4G26120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289189 psmD10 "26S proteasome non-ATPase regulatory subunit 10" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|621887 Nfkbib "nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:104752 Nfkbib "nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96DX5 ASB9 "Ankyrin repeat and SOCS box protein 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M1I7NPR6_ARATHNo assigned EC number0.74100.88930.9635nono
Q9ZVC2NPR5_ARATHNo assigned EC number0.77900.93080.9592yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00025314001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (490 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-14
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 5e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-12
pfam00651101 pfam00651, BTB, BTB/POZ domain 2e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-06
pfam1190048 pfam11900, DUF3420, Domain of unknown function (DU 2e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-06
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-05
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 4e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
 Score = 67.3 bits (165), Expect = 5e-14
 Identities = 39/89 (43%), Positives = 55/89 (61%), Gaps = 4/89 (4%)

Query: 263 ALDSSDVELVKLMV-MGEGLNL-DEALALHYAVENCSREVVKALLELGAADVNYPAGPAG 320
           A  + ++ELVKL++  G  +NL D   ALH A  N + E+VK LLE GA DVN      G
Sbjct: 4   AAKNGNLELVKLLLEKGADVNLGDTDTALHLAARNGNLEIVKLLLEHGA-DVNAKDK-DG 61

Query: 321 KTPLHIAAEMVSPDMVAVLLDHHADPNVR 349
            T LH+AA   + ++V +LL+H AD N++
Sbjct: 62  NTALHLAARNGNLEIVKLLLEHGADINLK 90


Length = 91

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|192869 pfam11900, DUF3420, Domain of unknown function (DUF3420) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 506
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.98
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02874 434 ankyrin repeat protein; Provisional 99.95
PHA02878 477 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA03095 471 ankyrin-like protein; Provisional 99.95
PHA02946 446 ankyin-like protein; Provisional 99.95
PHA02874 434 ankyrin repeat protein; Provisional 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02989 494 ankyrin repeat protein; Provisional 99.94
PHA03100 480 ankyrin repeat protein; Provisional 99.94
PHA02791284 ankyrin-like protein; Provisional 99.94
PHA02878 477 ankyrin repeat protein; Provisional 99.94
PHA02798 489 ankyrin-like protein; Provisional 99.94
PHA02875 413 ankyrin repeat protein; Provisional 99.93
PHA02946 446 ankyin-like protein; Provisional 99.93
PHA03095 471 ankyrin-like protein; Provisional 99.93
PHA03100 480 ankyrin repeat protein; Provisional 99.93
PHA02875 413 ankyrin repeat protein; Provisional 99.93
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.93
PHA02876 682 ankyrin repeat protein; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.92
KOG0508 615 consensus Ankyrin repeat protein [General function 99.92
PHA02917 661 ankyrin-like protein; Provisional 99.91
PHA02876 682 ankyrin repeat protein; Provisional 99.91
PHA02713557 hypothetical protein; Provisional 99.9
PHA02859209 ankyrin repeat protein; Provisional 99.9
KOG0510 929 consensus Ankyrin repeat protein [General function 99.9
PHA02917 661 ankyrin-like protein; Provisional 99.9
KOG4591280 consensus Uncharacterized conserved protein, conta 99.9
PHA02798 489 ankyrin-like protein; Provisional 99.89
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.89
PHA02795437 ankyrin-like protein; Provisional 99.88
PHA02790480 Kelch-like protein; Provisional 99.87
KOG4350 620 consensus Uncharacterized conserved protein, conta 99.87
PHA02989 494 ankyrin repeat protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0508 615 consensus Ankyrin repeat protein [General function 99.86
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.86
PHA02792 631 ankyrin-like protein; Provisional 99.86
PLN03192823 Voltage-dependent potassium channel; Provisional 99.85
PHA02730 672 ankyrin-like protein; Provisional 99.85
PHA02736154 Viral ankyrin protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA03098534 kelch-like protein; Provisional 99.84
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.84
KOG0514452 consensus Ankyrin repeat protein [General function 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.83
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.82
PHA02795437 ankyrin-like protein; Provisional 99.81
PLN03192823 Voltage-dependent potassium channel; Provisional 99.81
PHA02730 672 ankyrin-like protein; Provisional 99.81
PHA02741169 hypothetical protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.8
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.76
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.76
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.75
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
PHA02743166 Viral ankyrin protein; Provisional 99.74
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.73
KOG0514452 consensus Ankyrin repeat protein [General function 99.72
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.72
PHA02736154 Viral ankyrin protein; Provisional 99.71
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.62
PHA02792631 ankyrin-like protein; Provisional 99.62
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.61
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.58
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.55
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.54
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.52
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.52
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.49
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.42
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.42
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.39
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.34
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.32
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.31
KOG4682488 consensus Uncharacterized conserved protein, conta 99.3
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.23
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.2
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.97
PF1360630 Ank_3: Ankyrin repeat 98.86
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.81
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.8
PF1360630 Ank_3: Ankyrin repeat 98.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.63
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.6
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.56
KOG0522 560 consensus Ankyrin repeat protein [General function 98.52
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.49
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.48
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.46
KOG0522 560 consensus Ankyrin repeat protein [General function 98.43
KOG2838401 consensus Uncharacterized conserved protein, conta 98.38
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.36
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.19
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.16
KOG0511516 consensus Ankyrin repeat protein [General function 98.11
KOG2838401 consensus Uncharacterized conserved protein, conta 98.08
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.01
KOG0511 516 consensus Ankyrin repeat protein [General function 98.01
KOG2384223 consensus Major histocompatibility complex protein 97.98
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.9
KOG2384223 consensus Major histocompatibility complex protein 97.82
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.8
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.7
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.56
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.48
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.02
KOG2505591 consensus Ankyrin repeat protein [General function 96.81
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.66
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 96.58
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 96.51
KOG2505591 consensus Ankyrin repeat protein [General function 96.13
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.03
KOG3473112 consensus RNA polymerase II transcription elongati 95.98
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 94.74
KOG2714465 consensus SETA binding protein SB1 and related pro 94.4
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.53
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 91.93
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.47
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.97
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 88.13
PHA02790480 Kelch-like protein; Provisional 87.43
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 84.86
PHA02713557 hypothetical protein; Provisional 84.51
KOG1665302 consensus AFH1-interacting protein FIP2, contains 80.81
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.98  E-value=3.2e-33  Score=237.57  Aligned_cols=174  Identities=23%  Similarity=0.214  Sum_probs=149.1

Q ss_pred             CCccccHHHHHHHhcCCHHHHHHHHhcCCCCC-----CChHHHHHHHHcCCHHHHHHHHHc-CCCCCCCCCCCCCChHHH
Q 010590          252 LEDQKIRRMRRALDSSDVELVKLMVMGEGLNL-----DEALALHYAVENCSREVVKALLEL-GAADVNYPAGPAGKTPLH  325 (506)
Q Consensus       252 ~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~d~-----~g~t~Lh~A~~~g~~~~v~~Ll~~-g~~~v~~~~~~~g~tpLh  325 (506)
                      .|..|+|||||||..|+.+++.+|+...++.+     .||||||.||..|+.++|+.|+.+ |+ |+|..+ ..|.||||
T Consensus        34 ~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~a-dvna~t-n~G~T~LH  111 (226)
T KOG4412|consen   34 DDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGA-DVNATT-NGGQTCLH  111 (226)
T ss_pred             ccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCC-Ccceec-CCCcceeh
Confidence            35689999999999999999999996666654     399999999999999999999999 88 999999 89999999


Q ss_pred             HHHHhCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHHHHHHHHcCCCCCCcccCCChHHHHHHHHHhccCccccccCCC
Q 010590          326 IAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGIL  405 (506)
Q Consensus       326 ~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~tpLh~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~~~  405 (506)
                      ||+..|+.+++++|+++|+.++++|..|.||||-|+.                  -++++++.+|+..|+.+|..     
T Consensus       112 yAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAa------------------vGklkvie~Li~~~a~~n~q-----  168 (226)
T KOG4412|consen  112 YAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAA------------------VGKLKVIEYLISQGAPLNTQ-----  168 (226)
T ss_pred             hhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHh------------------ccchhhHHHHHhcCCCCCcc-----
Confidence            9999999999999999999999999999999999997                  68999999999999999998     


Q ss_pred             CCCCCCCccccCCCCCCccCccCCCCCCCCCccccccccccCCCcceeeccCCCCCCCcchhhhh
Q 010590          406 NEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQ  470 (506)
Q Consensus       406 ~~~~~~~~~~~tplh~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ln~~D~~G~T~LH~Aa~  470 (506)
                            |..|+||||.|-....           .....++.  ..++++...|+.| |||-.|+.
T Consensus       169 ------Dk~G~TpL~~al~e~~-----------~d~a~lLV--~~gAd~~~edke~-t~~~~a~~  213 (226)
T KOG4412|consen  169 ------DKYGFTPLHHALAEGH-----------PDVAVLLV--RAGADTDREDKEG-TALRIACN  213 (226)
T ss_pred             ------cccCccHHHHHHhccC-----------chHHHHHH--HhccceeeccccC-chHHHHHH
Confidence                  5567799999722111           11111222  3447899999999 99888764



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 3e-08
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 6e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-07
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 8e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-06
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-06
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 7e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 8e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 9e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-05
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 7e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-04
1uoh_A226 Human Gankyrin Length = 226 9e-04
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure

Iteration: 1

Score = 63.9 bits (154), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 38/82 (46%), Positives = 48/82 (58%), Gaps = 2/82 (2%) Query: 289 LHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNV 348 LHYA EN +E+VK LL GA D N G+TPLH AAE ++V +LL ADPN Sbjct: 74 LHYAAENGHKEIVKLLLSKGA-DPNAKDSD-GRTPLHYAAENGHKEIVKLLLSKGADPNT 131 Query: 349 RTVDGVTPLDILRTLTSDFLFK 370 DG TPLD+ R ++ + K Sbjct: 132 SDSDGRTPLDLAREHGNEEIVK 153
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-06
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-05
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-05
2rfa_A232 Transient receptor potential cation channel subfa 3e-15
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 6e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-11
2rfa_A232 Transient receptor potential cation channel subfa 7e-11
2rfa_A232 Transient receptor potential cation channel subfa 4e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-13
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-09
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-07
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 5e-12
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 7e-12
2pnn_A273 Transient receptor potential cation channel subfa 8e-12
2pnn_A273 Transient receptor potential cation channel subfa 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 9e-07
2pnn_A273 Transient receptor potential cation channel subfa 5e-06
2pnn_A273 Transient receptor potential cation channel subfa 7e-04
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 5e-09
2etb_A256 Transient receptor potential cation channel subfam 5e-07
2etb_A256 Transient receptor potential cation channel subfam 5e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 3e-10
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-10
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 4e-10
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 7e-10
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 7e-10
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 1e-09
3b84_A119 Zinc finger and BTB domain-containing protein 48; 1e-09
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-09
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 2e-09
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 2e-09
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-09
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 6e-08
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 4e-07
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-07
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 1e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 2e-18
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 288 ALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPN 347
            LH A  +    +V+ L+ LGA DVN      G+T LH+A ++ +PD+V++LL   AD N
Sbjct: 120 CLHLASIHGYLGIVELLVSLGA-DVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVN 178

Query: 348 VRTVDGVTPLDI 359
             T  G +P  +
Sbjct: 179 RVTYQGYSPYQL 190


>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.95
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.95
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
2pnn_A273 Transient receptor potential cation channel subfa 99.95
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.95
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.95
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.95
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.95
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
2pnn_A273 Transient receptor potential cation channel subfa 99.92
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.92
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.92
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.91
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.91
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.91
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.91
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.91
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.9
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.9
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.9
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.9
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.9
2vpk_A116 Myoneurin; transcription regulation, transcription 99.9
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.9
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.9
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.89
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.89
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.89
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.89
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.87
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.85
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.31
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.12
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.81
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.68
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.03
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.02
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.0
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 97.87
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.07
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.78
3kvt_A115 Potassium channel protein SHAW; tetramerization do 93.74
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 91.74
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 89.51
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 87.69
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 82.2
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 81.61
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
Probab=99.97  E-value=3.8e-31  Score=253.11  Aligned_cols=180  Identities=17%  Similarity=0.155  Sum_probs=157.4

Q ss_pred             cCCccccHHHHHHHhcCCHHHHHHHHhcCCCCC-----CChHHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCChHHH
Q 010590          251 DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNL-----DEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLH  325 (506)
Q Consensus       251 ~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~d~-----~g~t~Lh~A~~~g~~~~v~~Ll~~g~~~v~~~~~~~g~tpLh  325 (506)
                      ..|..|.||||+|+..|+.+++++|+ +.|+++     +|+||||+|+..|+.+++++|++.|+.+++.++ ..|+||||
T Consensus        52 ~~d~~g~t~L~~A~~~g~~~~v~~Ll-~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~-~~g~t~L~  129 (253)
T 1yyh_A           52 QTDRTGETALHLAARYSRSDAAKRLL-EASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARM-HDGTTPLI  129 (253)
T ss_dssp             CCCTTSCCHHHHHHHTTCHHHHHHHH-HTTCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHSTTSCTTCCC-TTCCCHHH
T ss_pred             ccCCCCCcHHHHHHHcCCHHHHHHHH-HcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCccccC-CCCCcHHH
Confidence            35788999999999999999999999 667655     489999999999999999999999876899998 89999999


Q ss_pred             HHHHhCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHHHHHHHHcCCCCCCcccCCChHHHHHHHHHhccCccccccCCC
Q 010590          326 IAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGIL  405 (506)
Q Consensus       326 ~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~tpLh~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~~~  405 (506)
                      +|+..|+.+++++|+++|++++.+|..|+||||+|+.                  .++.+++++|++.|++++.+     
T Consensus       130 ~A~~~~~~~~v~~Ll~~g~~~~~~d~~g~t~L~~A~~------------------~~~~~~v~~Ll~~ga~~~~~-----  186 (253)
T 1yyh_A          130 LAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAA------------------VNNVDAAVVLLKNGANKDMQ-----  186 (253)
T ss_dssp             HHHHHTCSSHHHHHHHTTCCTTCBCTTSCBHHHHHHH------------------HTCHHHHHHHHHTTCCTTCC-----
T ss_pred             HHHHcChHHHHHHHHHcCCCCCCcCCCCCCHHHHHHH------------------cCCHHHHHHHHHcCCCCCCc-----
Confidence            9999999999999999999999999999999999998                  68899999999999999987     


Q ss_pred             CCCCCCCccccCCCCCCccCccCCCCCCCCCccccccccccCCCcceeeccCCCCCCCcchhhhhcCCC
Q 010590          406 NEPSSSTATVIYPPPMSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSS  474 (506)
Q Consensus       406 ~~~~~~~~~~~tplh~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ln~~D~~G~T~LH~Aa~~gs~  474 (506)
                            +..|.||||+|+...           ...++++++  +.++++|.+|..|+||||+|++.|..
T Consensus       187 ------~~~g~tpL~~A~~~~-----------~~~~v~~Ll--~~ga~~~~~d~~g~tpl~~A~~~g~~  236 (253)
T 1yyh_A          187 ------NNREETPLFLAAREG-----------SYETAKVLL--DHFANRDITDHMDRLPRDIAQERMHH  236 (253)
T ss_dssp             ------CTTSCCHHHHHHHHT-----------CHHHHHHHH--HTTCCTTCCCTTCCCHHHHHHHTTCH
T ss_pred             ------CCCCCCHHHHHHHCC-----------CHHHHHHHH--HcCCCccccccCCCCHHHHHHHcCCH
Confidence                  556779999985322           223344455  34578999999999999999999954



>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 506
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.8 bits (167), Expect = 4e-13
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 288 ALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPN 347
            LH A       +VK LL+ GA   N       +TPLH+AA     ++   LL + A  N
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGA-SPNVS-NVKVETPLHMAARAGHTEVAKYLLQNKAKVN 60

Query: 348 VRTVDGVTPLDI 359
            +  D  TPL  
Sbjct: 61  AKAKDDQTPLHC 72


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.92
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.87
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.87
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.81
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.81
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.73
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.69
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 96.6
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 96.26
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.02
d1t1da_100 Shaker potassium channel {California sea hare (Apl 94.98
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 94.95
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 94.87
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 94.29
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=6.4e-30  Score=242.04  Aligned_cols=182  Identities=16%  Similarity=0.113  Sum_probs=153.1

Q ss_pred             ccCCccccHHHHHHHhcCCHHHHHHHHhcCCCC--------CCChHHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCC
Q 010590          250 ADLEDQKIRRMRRALDSSDVELVKLMVMGEGLN--------LDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGK  321 (506)
Q Consensus       250 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~d--------~~g~t~Lh~A~~~g~~~~v~~Ll~~g~~~v~~~~~~~g~  321 (506)
                      ...+++|.||||+||..|+.+++++|| +.|++        .+|+||||+||..|+.+++++|++.|+ +++.+| ..|+
T Consensus         3 ~~i~~~G~t~Lh~A~~~~~~~~v~~Ll-~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga-~i~~~d-~~g~   79 (255)
T d1oy3d_           3 GYVTEDGDTALHLAVIHQHEPFLDFLL-GFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGA-GVLVAE-RGGH   79 (255)
T ss_dssp             CCCCTTCCCHHHHHHHTTCHHHHHHHH-HHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTC-CSSCCC-TTSC
T ss_pred             ccCCcCCCCHHHHHHHcCCHHHHHHHH-HcCCCcccccCcCCCCCCccchHHhhcccccccccccccc-cccccc-cccc
Confidence            356899999999999999999999999 44432        368999999999999999999999999 999999 8999


Q ss_pred             hHHHHHHHhCCHHHHHHHHHCCC-----------------------------------------------CCCCCCCCCC
Q 010590          322 TPLHIAAEMVSPDMVAVLLDHHA-----------------------------------------------DPNVRTVDGV  354 (506)
Q Consensus       322 tpLh~A~~~~~~~~v~~Ll~~ga-----------------------------------------------~~~~~d~~g~  354 (506)
                      ||||+|+..++.+++++|++.+.                                               +++.+|.+|+
T Consensus        80 tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~  159 (255)
T d1oy3d_          80 TALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGH  159 (255)
T ss_dssp             CHHHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSC
T ss_pred             hhhhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCc
Confidence            99999999999999998865432                                               3356788999


Q ss_pred             cHHHHHHHHHHHHHHcCCCCCCcccCCChHHHHHHHHHhccCccccccCCCCCCCCCCccccCCCCCCccCccCCCCCCC
Q 010590          355 TPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNNSSS  434 (506)
Q Consensus       355 tpLh~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~tplh~a~~~~~~~~~~~~  434 (506)
                      ||||+|+.                  .++.+++++|++.|++++..          .+..|.||||+|+...        
T Consensus       160 TpLh~A~~------------------~~~~~~v~~Ll~~~~~~~~~----------~~~~g~TpL~~A~~~~--------  203 (255)
T d1oy3d_         160 TPLHVAVI------------------HKDAEMVRLLRDAGADLNKP----------EPTCGRTPLHLAVEAQ--------  203 (255)
T ss_dssp             CHHHHHHH------------------TTCHHHHHHHHHHTCCTTCC----------CTTTCCCHHHHHHHTT--------
T ss_pred             cccccccc------------------ccccccccchhccccccccc----------cccccccccccccccc--------
Confidence            99999998                  78999999999999988865          3457889999985322        


Q ss_pred             CCccccccccccCCCcceeeccCCCCCCCcchhhhhcCCCC
Q 010590          435 GSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSR  475 (506)
Q Consensus       435 ~~~~~~~~~~~~~~~~~~~ln~~D~~G~T~LH~Aa~~gs~~  475 (506)
                         ....+++++  +.++++|.+|..|+||||+|+..|+..
T Consensus       204 ---~~~~v~~Ll--~~gadin~~d~~g~t~L~~A~~~~~~~  239 (255)
T d1oy3d_         204 ---AASVLELLL--KAGADPTARMYGGRTPLGSALLRPNPI  239 (255)
T ss_dssp             ---CHHHHHHHH--HTTCCTTCCCTTSCCHHHHHHTSSCHH
T ss_pred             ---HHHHHHHHH--HCCCCCCCCCCCCCCHHHHHHHCCCHH
Confidence               233445555  345899999999999999999999654



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure