Citrus Sinensis ID: 010623


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MADQYTWGLILGAVLGLVAVYNLGLLALYNLVMRSKSEDNGADSLRKTPTTALNGECPFDADVIVVGAGVAGAALANTLAKDGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGLEDCVEQIDAQRVFGYALFKDGNRTQISYPLEKFHSDVAGRGFHNGRFVQRLREKAASLPNVRLEQGTVTSLLEEKGTIKGVQYKTKAGEELTAYAPLTIVCDGCFSNLRRSLCNPKVDVPSCFVGLVLENCNLPFENHGHVVLADPSPILFYPISSNEVRCLVDIPGQKVPSISNGEMANYLKTVVAPQIPREIFHSFVAAVDGGNIKTMPNRSMPAAPYPTPGALLMGDAFNMRHPLTGGGMTVALSDIVILRNLLRHLSNLNDAPALCNYLESFYTLRKPVASTINTLAGALYQVFSASPDEARKEMRQACFDYLSLGGIFSSGPVSLLSGLNPRPLILVFHFFAVAIYGVGRILLPFPSPYRFWIGARIITVCILPAMLDNQIFLL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccEEEECccHHHHHHHHccccHHHHHcccEEEEEEEEEEccCEEEEECcccccccccCEEEECcHHHHHHHHHHHHccccCEEEccEEEEEEECccEEEEEEEEEccccEEEEEccEEEEccccccHHHHHHccccccccccEEEEEEECcccccccCEEEEEccccCEEEEEcccccEEEEEECccccccccccccHHHHHHHHccccccHHHHHHHHHHHHccccCECccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccc
**DQYTWGLILGAVLGLVAVYNLGLLALYNLVM************************PFDADVIVVGAGVAGAALANTLAKDGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGLEDCVEQIDAQRVFGYALFKDGNRTQISYPLEKFHSDVAGRGFHNGRFVQRLREKAASLPNVRLEQGTVTSLLEEKGTIKGVQYKTKAGEELTAYAPLTIVCDGCFSNLRRSLCNPKVDVPSCFVGLVLENCNLPFENHGHVVLADPSPILFYPISSNEVRCLVDIPGQKVPSISNGEMANYLKTVVAPQIPREIFHSFVAAVDGGNIKTMPNRSMPAAPYPTPGALLMGDAFNMRHPLTGGGMTVALSDIVILRNLLRHLSNLNDAPALCNYLESFYTLRKPVASTINTLAGALYQVFSASPDEARKEMRQACFDYLSLGGIFSSGPVSLLSGLNPRPLILVFHFFAVAIYGVGRILLPFPSPYRFWIGARIITVCILPAMLDNQIFLL
xxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADQYTWGLILGAVLGLVAVYNLGLLALYNLVMRSKSEDNGADSLRKTPTTALNGECPFDADVIVVGAGVAGAALANTLAKDGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGLEDCVEQIDAQRVFGYALFKDGNRTQISYPLEKFHSDVAGRGFHNGRFVQRLREKAASLPNVRLEQGTVTSLLEEKGTIKGVQYKTKAGEELTAYAPLTIVCDGCFSNLRRSLCNPKVDVPSCFVGLVLENCNLPFENHGHVVLADPSPILFYPISSNEVRCLVDIPGQKVPSISNGEMANYLKTVVAPQIPREIFHSFVAAVDGGNIKTMPNRSMPAAPYPTPGALLMGDAFNMRHPLTGGGMTVALSDIVILRNLLRHLSNLNDAPALCNYLESFYTLRKPVASTINTLAGALYQVFSASPDEARKEMRQACFDYLSLGGIFSSGPVSLLSGLNPRPLILVFHFFAVAIYGVGRILLPFPSPYRFWIGARIITVCILPAMLDNQIFLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Squalene monooxygenase 1,1 Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.probableO65727
Squalene monooxygenase Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.probableO13306
Squalene monooxygenase Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.probableP32476

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.99.-Miscellaneous (requires further characterization).probable
1.14.99.7Transferred entry: 1.14.13.132.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X3N, chain A
Confidence level:very confident
Coverage over the Query: 60-429
View the alignment between query and template
View the model in PyMOL
Template: 2DKH, chain A
Confidence level:very confident
Coverage over the Query: 58-477
View the alignment between query and template
View the model in PyMOL