Citrus Sinensis ID: 010628
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 505 | ||||||
| 224115866 | 772 | predicted protein [Populus trichocarpa] | 0.998 | 0.652 | 0.837 | 0.0 | |
| 343157312 | 772 | early-responsive to dehydration-related | 0.990 | 0.647 | 0.832 | 0.0 | |
| 225444327 | 766 | PREDICTED: uncharacterized membrane prot | 0.986 | 0.650 | 0.794 | 0.0 | |
| 225444325 | 771 | PREDICTED: uncharacterized membrane prot | 0.986 | 0.645 | 0.794 | 0.0 | |
| 255554789 | 773 | conserved hypothetical protein [Ricinus | 0.994 | 0.649 | 0.845 | 0.0 | |
| 449455385 | 773 | PREDICTED: uncharacterized membrane prot | 0.990 | 0.646 | 0.816 | 0.0 | |
| 62319788 | 771 | hypothetical protein [Arabidopsis thalia | 0.990 | 0.648 | 0.8 | 0.0 | |
| 42567026 | 771 | early-responsive to dehydration stress-r | 0.990 | 0.648 | 0.8 | 0.0 | |
| 449519707 | 773 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.990 | 0.646 | 0.816 | 0.0 | |
| 224099861 | 771 | predicted protein [Populus trichocarpa] | 0.990 | 0.648 | 0.816 | 0.0 |
| >gi|224115866|ref|XP_002317144.1| predicted protein [Populus trichocarpa] gi|222860209|gb|EEE97756.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 858 bits (2216), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 422/504 (83%), Positives = 464/504 (92%)
Query: 1 MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK 60
MATL DI VS ALN+LGAFIFL+AFAILR+QPFNDRVYFPKWYLKGLR S +H GAF R+
Sbjct: 1 MATLGDIAVSGALNLLGAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSASHSGAFARR 60
Query: 61 FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL 120
VNLDFRSY RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA +AW++L
Sbjct: 61 IVNLDFRSYTRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAIL 120
Query: 121 VPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKE 180
VPVN+TNDTL+ A +SNVTASDIDKLSISNVPLKSQRFW H+VMAYAFTFWTCYVLLKE
Sbjct: 121 VPVNYTNDTLEKAQLVSNVTASDIDKLSISNVPLKSQRFWAHIVMAYAFTFWTCYVLLKE 180
Query: 181 YEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVV 240
YEK+A++RLQF++SE RRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHP+HYL HQVV
Sbjct: 181 YEKIASMRLQFLSSEGRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPHHYLIHQVVC 240
Query: 241 NANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEK 300
NANKLA LVKKKK QNWLDYYQLKY RN S+RP+ KTGFLGLWGEKVD ID+HISEI+K
Sbjct: 241 NANKLASLVKKKKSKQNWLDYYQLKYDRNQSQRPLKKTGFLGLWGEKVDAIDHHISEIKK 300
Query: 301 LSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVY 360
LS+EI EERE+V+ DPK+IMPAAFVSF +RWGAAVCAQTQQ+RNPTLWLTEWA EPRDVY
Sbjct: 301 LSEEIEEEREKVLKDPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVY 360
Query: 361 WQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKF 420
W+NLAIPY+SLSVRRLI+GVAFFFLTFFFMIPIA VQ+ ASIEGIEK PFLKP+IE KF
Sbjct: 361 WENLAIPYMSLSVRRLIIGVAFFFLTFFFMIPIASVQALASIEGIEKKAPFLKPIIEIKF 420
Query: 421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGS 480
IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGF+S+SSLERR+ATRYY+F +NVFLGS
Sbjct: 421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFLSISSLERRSATRYYIFLIINVFLGS 480
Query: 481 IIAGTAFEQLNSFLKQSANEYVAT 504
I+AG AFEQLNSF+ QSANE T
Sbjct: 481 ILAGAAFEQLNSFINQSANEIPKT 504
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|343157312|gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica] | Back alignment and taxonomy information |
|---|
| >gi|225444327|ref|XP_002264591.1| PREDICTED: uncharacterized membrane protein C24H6.13 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225444325|ref|XP_002264502.1| PREDICTED: uncharacterized membrane protein C24H6.13 isoform 1 [Vitis vinifera] gi|302144095|emb|CBI23200.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255554789|ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis] gi|223542277|gb|EEF43819.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449455385|ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|62319788|dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42567026|ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|145333700|ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512288|ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512292|ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512296|ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|334186802|ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|53828549|gb|AAU94384.1| At4g22120 [Arabidopsis thaliana] gi|57444911|gb|AAW50707.1| At4g22120 [Arabidopsis thaliana] gi|332659154|gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659155|gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659156|gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659157|gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659158|gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659159|gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449519707|ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224099861|ref|XP_002334434.1| predicted protein [Populus trichocarpa] gi|222872071|gb|EEF09202.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 505 | ||||||
| TAIR|locus:2120673 | 771 | AT4G22120 [Arabidopsis thalian | 0.998 | 0.653 | 0.748 | 5.8e-208 | |
| TAIR|locus:2027119 | 769 | AT1G62320 "AT1G62320" [Arabido | 0.992 | 0.651 | 0.716 | 4.2e-198 | |
| TAIR|locus:2008860 | 771 | AT1G11960 "AT1G11960" [Arabido | 0.996 | 0.652 | 0.720 | 8.7e-198 | |
| TAIR|locus:2134882 | 772 | AT4G04340 [Arabidopsis thalian | 0.998 | 0.652 | 0.708 | 1.1e-195 | |
| TAIR|locus:2089850 | 756 | AT3G21620 "AT3G21620" [Arabido | 0.992 | 0.662 | 0.692 | 4.6e-192 | |
| TAIR|locus:2130130 | 761 | AT4G15430 "AT4G15430" [Arabido | 0.996 | 0.660 | 0.666 | 5.2e-184 | |
| TAIR|locus:2140210 | 785 | AT4G02900 [Arabidopsis thalian | 0.992 | 0.638 | 0.640 | 3.1e-177 | |
| TAIR|locus:2031735 | 806 | AT1G32090 "AT1G32090" [Arabido | 0.994 | 0.622 | 0.576 | 2.2e-160 | |
| TAIR|locus:2102117 | 703 | HYP1 "hypothetical protein 1" | 0.815 | 0.586 | 0.308 | 1e-59 | |
| TAIR|locus:2204227 | 724 | ERD4 "early-responsive to dehy | 0.932 | 0.650 | 0.300 | 8.6e-56 |
| TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2011 (713.0 bits), Expect = 5.8e-208, P = 5.8e-208
Identities = 377/504 (74%), Positives = 430/504 (85%)
Query: 1 MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK 60
MATL DIGVSA +NIL AF+F I FA+LRLQPFNDRVYF KWYLKGLR SP GGAF ++
Sbjct: 1 MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR 60
Query: 61 FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL 120
FVNLDFRSY++FLNWMPEALKMPEPELI+HAGLDS VYLRIY +GLKIF PIA++AW+VL
Sbjct: 61 FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL 120
Query: 121 VPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKE 180
VPVNWTN+TL++A ++ NVT+SDIDKLS+SN+P S RFWTH+VMAYAFT WTCYVL+KE
Sbjct: 121 VPVNWTNNTLEMAKQLRNVTSSDIDKLSVSNIPEYSMRFWTHIVMAYAFTIWTCYVLMKE 180
Query: 181 YEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQXXX 240
YE +AN+RLQFVASE RRPDQFTVLVRNVPPD DESVSELVEHFFLVNHP+HYLTHQ
Sbjct: 181 YETIANMRLQFVASEARRPDQFTVLVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVC 240
Query: 241 XXXXXXXXXXXXXXXQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEK 300
QNWLDYYQLKY+RNNS+R M+K GFLGLWG+KVD I+++I+EI+K
Sbjct: 241 NANKLADLVKKKKKLQNWLDYYQLKYARNNSQRIMVKLGFLGLWGQKVDAIEHYIAEIDK 300
Query: 301 LSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVY 360
+SKEI++ERE VV+DPKAIMPAAFVSF +RW AAVCAQTQQTRNPT WLTEWA EPRDV+
Sbjct: 301 ISKEISKEREEVVNDPKAIMPAAFVSFKTRWAAAVCAQTQQTRNPTQWLTEWAPEPRDVF 360
Query: 361 WQNLAIPYVSLSVRRLIMGVAXXXXXXXXMIPIAIVQSFASIEGIEKAVPFLKPVIEAKF 420
W NLAIPYVSL+VRRLIM VA ++PIA VQS A+IEGI KA PFLK +++ KF
Sbjct: 361 WSNLAIPYVSLTVRRLIMHVAFFFLTFFFIVPIAFVQSLATIEGIVKAAPFLKFIVDDKF 420
Query: 421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGS 480
+KSVIQGFLPGIALKLFL FLP+ILMIMSKFEGF S+SSLERRAA RYY+FN VNVFL S
Sbjct: 421 MKSVIQGFLPGIALKLFLAFLPSILMIMSKFEGFTSISSLERRAAFRYYIFNLVNVFLAS 480
Query: 481 IIAGTAFEQLNSFLKQSANEYVAT 504
+IAG AFEQLNSFL QSAN+ T
Sbjct: 481 VIAGAAFEQLNSFLNQSANQIPKT 504
|
|
| TAIR|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204227 ERD4 "early-responsive to dehydration 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 505 | |||
| pfam02714 | 325 | pfam02714, DUF221, Domain of unknown function DUF2 | 4e-59 | |
| COG5594 | 827 | COG5594, COG5594, Uncharacterized integral membran | 5e-45 | |
| pfam13967 | 151 | pfam13967, RSN1_TM, Late exocytosis, associated wi | 5e-45 |
| >gnl|CDD|190398 pfam02714, DUF221, Domain of unknown function DUF221 | Back alignment and domain information |
|---|
Score = 197 bits (504), Expect = 4e-59
Identities = 63/175 (36%), Positives = 96/175 (54%), Gaps = 1/175 (0%)
Query: 323 AFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAF 382
AFV+F S+ A + AQ Q NP W T A EPRD+ W+NL++ +RRLI+ +
Sbjct: 1 AFVTFKSQAAAQMAAQALQHHNPLKWPTYLAPEPRDIIWENLSLSRWERWLRRLIVNLLL 60
Query: 383 FFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEA-KFIKSVIQGFLPGIALKLFLIFL 441
F L F+ IP+A V +++E + K PFLK +++ + ++ G LP + L L + L
Sbjct: 61 FLLIIFWAIPVAFVGLLSNLETLTKVWPFLKWILDLPPVLLGLVTGLLPTLLLSLLMALL 120
Query: 442 PTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQ 496
P IL +SK +G S S +E ++Y+ F VNVFL +A TA + +
Sbjct: 121 PIILRFLSKLQGHPSRSDVELSVQSKYFAFLVVNVFLVVTLASTASSLITEIIDN 175
|
This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length. Length = 325 |
| >gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 505 | |||
| COG5594 | 827 | Uncharacterized integral membrane protein [Functio | 100.0 | |
| KOG1134 | 728 | consensus Uncharacterized conserved protein [Gener | 100.0 | |
| PF02714 | 325 | DUF221: Domain of unknown function DUF221; InterPr | 100.0 | |
| PF13967 | 157 | RSN1_TM: Late exocytosis, associated with Golgi tr | 100.0 | |
| PF14703 | 85 | DUF4463: Domain of unknown function (DUF4463) | 99.02 | |
| PF04547 | 452 | Anoctamin: Calcium-activated chloride channel; Int | 97.45 | |
| KOG2513 | 647 | consensus Protein required for meiotic chromosome | 97.02 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 96.79 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 95.8 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 95.6 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 95.59 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 95.55 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 95.45 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 95.36 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 94.82 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 94.7 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 94.14 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 92.74 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 92.32 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 91.99 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 91.88 | |
| KOG2514 | 861 | consensus Uncharacterized conserved protein [Funct | 90.76 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 90.71 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 89.28 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 89.16 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 88.77 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 88.75 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 87.46 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 86.76 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 85.62 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 85.3 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 83.12 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 82.35 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 81.92 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 81.59 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 81.2 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 80.05 |
| >COG5594 Uncharacterized integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-86 Score=686.89 Aligned_cols=476 Identities=26% Similarity=0.445 Sum_probs=426.8
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCccccccccccCCC-CCCCCCCcccccccccccccccccccchhhhcC
Q 010628 3 TLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLR-DSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALK 81 (505)
Q Consensus 3 ~~~~~~~~l~~~~~~~~~~~~~F~~lR~~~~~~~iY~pr~~~~~~~-~~p~~~~~~~~~~~~l~~~~~~~~~~Wi~~~~~ 81 (505)
+.++++|+++++..++++++++|++||+| ++++|+||+..++.+ +.| ++.|+|+|||+.++++
T Consensus 20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~~~~P--------------~~~~ss~~gWl~~L~~ 83 (827)
T COG5594 20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQNECLP--------------EPNPSSYWGWLEPLVK 83 (827)
T ss_pred chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCCcccC--------------CCCccchHHHHHHHHh
Confidence 47899999999999999999999999986 899999999877643 223 3567899999999999
Q ss_pred CChhHHHHhcCccHHHHHHHHHHHHHHHHHHHHHHHhhhcceeeeCCCccccccccCcCCCccccccccCcCCCCchHHH
Q 010628 82 MPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWT 161 (505)
Q Consensus 82 ~~~~~i~~~~GlDa~~~lrfl~~~~~~f~~~~~~~~~iLlPvn~~~~~~~~~~~~~~~~~~~l~~~TisNv~~~s~~lw~ 161 (505)
++|+.+++++|+|||+||||+|||+++++++|+++++||+|+|++.++..+.. .-..++++++|++|+.+ ++++|+
T Consensus 84 i~d~~~l~~aGlD~y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~gn---~~s~s~l~~Ls~~Nv~~-~n~~~a 159 (827)
T COG5594 84 IPDEFLLQYAGLDGYFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATNGN---SDSESGLDKLSISNVSP-SNRLYA 159 (827)
T ss_pred CCHHHHHHHcCcchhhHHHHHHHHHHHHHHHHHHHhHEeeeeeecccccccCC---ccchhhhhHhhhhcccC-CCceee
Confidence 99999999999999999999999999999999999999999998875443210 11358999999999986 789999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC---------CCCcceEEEEcCCCCCCccHHHHHHHhhhhcCCCc
Q 010628 162 HVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKR---------RPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNH 232 (505)
Q Consensus 162 h~i~~~l~~~~~~~~l~~e~~~~~~~R~~~l~~~~~---------~~~~~TVlV~~IP~~~~~~~~~~l~~~f~~~~p~~ 232 (505)
|++..|++.++++|.+++|++.|+.+||++++++.. +.++||+++++||.+... .+.+.++|+++..++
T Consensus 160 Hvf~~~~f~~~vlfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~--~e~L~~~~~kl~~~~ 237 (827)
T COG5594 160 HVFLSWFFFGYVLFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS--DEELKELFDKLKVGE 237 (827)
T ss_pred eeehhHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC--chhHHHHHhhcCeee
Confidence 999999999999999999999999999999998752 348999999999997633 245888999988888
Q ss_pred eeeeEeEecchhHHHHHHHHHHHHHHHHHHHH-------hh-----hc--------------------CCCCCCcccccc
Q 010628 233 YLTHQVVVNANKLAKLVKKKKKLQNWLDYYQL-------KY-----SR--------------------NNSKRPMMKTGF 280 (505)
Q Consensus 233 v~~v~i~~d~~~L~~l~~~r~~~~~~le~~~~-------k~-----~k--------------------~~~~rp~~k~~~ 280 (505)
+.+..+|||.+.|++++++|++..+++|.+.+ |. .| ...+||++|.+-
T Consensus 238 i~~~~l~~~~~~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k 317 (827)
T COG5594 238 IDSDVLCRDLGTLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKK 317 (827)
T ss_pred eccchhhhhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhh
Confidence 98999999999999999999999999884321 11 01 013589888765
Q ss_pred c--cCCCCcccHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCeEEEEeCCHHHHHHHHHhcccCCCCCce-eeeCCCCC
Q 010628 281 L--GLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWL-TEWASEPR 357 (505)
Q Consensus 281 ~--~~~g~kvdai~~~~~~l~~l~~~I~~~~~~~~~~~~~~~~~AFVtF~s~~~a~~a~q~~~~~~~~~~~-v~~APeP~ 357 (505)
. ++.|+|||+|||+++++.+++++|++.|+...... ++++|||||+|+..||+|+|.+.++++.... ++.||+|+
T Consensus 318 ~~~~i~gKkVdaI~y~s~~l~~l~~~i~~~r~~~~~~t--~~~~~FItFkSq~~Aq~~aQ~~~~sr~~~~~~v~iapaPn 395 (827)
T COG5594 318 LNKGIFGKKVDAIDYYSAKLTKLDAEIENARKSLYENT--PTKSGFITFKSQASAQIAAQSQIYSRVLGKLKVEIAPAPN 395 (827)
T ss_pred hhhhhccceecHHHHHHHHHHHHHHHHHHHHhCccccC--ccccEEEEEehhHHHHHHHHhhhhhhhhcceeeeecCCcc
Confidence 5 67899999999999999999999999999865543 4679999999999999999999999987766 99999999
Q ss_pred CeecCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhHHhhcccchhh-hhchhHHHHHHhhhHHHHHHH
Q 010628 358 DVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPV-IEAKFIKSVIQGFLPGIALKL 436 (505)
Q Consensus 358 DIiW~NL~~s~~~r~~R~~~~~~~~~~liif~~iPva~v~~l~~~~~l~~~~p~l~~~-~~~~~~~~~i~~~lP~l~l~~ 436 (505)
||+|+|+..++++|..+++.+++++++++++|++|||+|+.++|+++|++.+||++.+ .+.|+++++++|+||++++.+
T Consensus 396 Di~W~Nl~ls~~~r~~k~~~~ni~~il~II~w~~pVa~v~~i~Nl~~l~~~~p~l~~il~~~~~l~~iltglLptv~~~~ 475 (827)
T COG5594 396 DIIWDNLRLSRKERLFKRISANILFILLIILWAFPVAFVGTISNLNTLSSLWPFLKFILKDPPFLAGILTGLLPTVALSL 475 (827)
T ss_pred ccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHhhhhHHHHHHHhccHHHHHHHHhhhhHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999 566799999999999999999
Q ss_pred HHHHHHHHHHHHHhhcCCcchhHHHHHHHhHHHHHHHHHHHHHHHhhHhHHHHHHHHHhcccccccC
Q 010628 437 FLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVA 503 (505)
Q Consensus 437 ~~~llP~ii~~ls~~eg~~T~S~~~~s~~~k~f~fl~~n~flv~~i~~s~~~~l~~~~~~p~~~i~~ 503 (505)
++.++|+++++++++||..|+|+.|+.++.|||.|+|+|+|+|++++|++.+.+.+++++| .||++
T Consensus 476 l~~ivP~fir~Ls~~qG~~S~se~E~~~~~k~~~f~fv~~FlV~Tl~s~fss~v~~~~ke~-~s~~~ 541 (827)
T COG5594 476 LMSIVPYFIRWLSYMQGLVSYSEEEIYVQNKYFAFLFVNLFLVVTLASSFSSIVWSLLKEP-TSIMT 541 (827)
T ss_pred HHHHhHHHHHHHHHhcCccchHHHHHHHHhhhhhheeeeehheeeehhHHHHHHHHHhcCh-HhHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999 78875
|
|
| >KOG1134 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length | Back alignment and domain information |
|---|
| >PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport | Back alignment and domain information |
|---|
| >PF14703 DUF4463: Domain of unknown function (DUF4463) | Back alignment and domain information |
|---|
| >PF04547 Anoctamin: Calcium-activated chloride channel; InterPro: IPR007632 This family contains the anoctamin/TMEM16 proteins which are thought to be calcium-dependent chloride channel [] | Back alignment and domain information |
|---|
| >KOG2513 consensus Protein required for meiotic chromosome segregation [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2514 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 505 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 48.3 bits (114), Expect = 5e-06
Identities = 44/281 (15%), Positives = 93/281 (33%), Gaps = 77/281 (27%)
Query: 72 FLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNW---TND 128
L + L +L + R+ +I I +A W NW D
Sbjct: 307 LLKY----LDCRPQDLPREVLTTNP--RRLSIIAESIRDGLAT--WD-----NWKHVNCD 353
Query: 129 TLDVAVKIS--NVTASDI----DKLSI----SNVPLKSQRFWTHVVMAYAFTFWTCYVLL 178
L ++ S + ++ D+LS+ +++P +++ W V+
Sbjct: 354 KLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI--------LLS---LIW-FDVIK 401
Query: 179 KEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHP--NHYLTH 236
+ V N ++ EK P ES + + + N Y H
Sbjct: 402 SDVMVVVNKLHKYSLVEK---------------QPKESTISIPSIYLELKVKLENEYALH 446
Query: 237 QVVVNANKLAKLVKKKKKLQNWLDYY-------QLKYSRNNSKRPMMKTGFLGL-W-GEK 287
+ +V+ + K + +LD Y LK + + + + FL + +K
Sbjct: 447 RSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQK 506
Query: 288 V--DGIDYH--------ISEIEKLSKEIAE---ERERVVSD 315
+ D ++ + +++ I + + ER+V+
Sbjct: 507 IRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNA 547
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 505 | |||
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 97.34 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 97.31 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 97.28 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 97.17 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 97.16 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 97.11 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 97.09 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 97.02 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 96.99 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 96.99 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 96.97 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 96.97 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 96.97 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 96.95 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 96.93 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 96.91 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 96.9 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 96.9 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 96.85 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 96.83 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.83 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 96.8 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.78 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 96.78 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 96.77 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 96.76 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 96.74 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 96.73 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 96.72 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 96.72 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 96.72 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 96.69 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 96.69 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 96.69 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 96.68 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 96.66 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 96.65 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 96.64 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 96.64 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 96.64 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 96.63 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 96.61 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 96.6 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 96.58 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 96.58 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 96.57 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 96.57 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 96.57 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 96.56 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 96.56 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 96.56 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 96.53 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 96.52 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 96.52 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 96.52 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 96.5 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 96.49 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 96.49 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 96.47 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 96.45 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 96.42 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 96.41 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 96.4 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 96.39 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 96.37 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 96.36 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 96.36 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 96.35 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 96.34 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 96.32 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 96.31 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 96.28 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 96.25 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 96.22 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 96.22 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 96.22 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 96.2 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 96.18 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 96.17 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 96.17 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 96.15 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 96.14 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.13 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 96.13 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 96.13 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 96.12 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 96.11 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 96.09 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 96.06 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 96.06 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 96.05 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 96.04 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 96.03 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 96.03 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 96.01 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 96.0 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.0 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 95.99 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 95.99 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 95.98 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 95.97 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 95.94 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 95.94 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 95.94 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 95.93 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 95.91 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 95.89 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 95.89 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 95.89 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 95.87 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 95.86 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 95.85 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 95.84 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 95.84 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 95.82 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 95.81 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 95.8 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 95.76 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 95.74 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 95.74 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 95.71 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 95.7 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 95.67 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 95.65 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 95.64 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 95.63 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 95.62 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 95.62 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 95.59 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 95.55 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 95.53 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 95.52 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 95.48 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 95.46 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 95.45 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 95.38 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.32 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 95.3 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 95.29 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 95.27 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.22 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 95.2 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 95.17 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 95.16 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 95.12 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 95.09 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 95.08 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 94.92 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 94.67 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 94.6 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 94.59 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 94.36 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 94.26 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 94.19 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 93.89 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 93.78 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 93.7 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 93.68 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 93.42 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 93.4 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 93.33 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 92.98 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 92.77 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 92.0 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 91.33 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 91.27 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 91.11 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 90.86 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 90.74 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 90.28 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 90.13 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 89.08 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 88.71 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 88.11 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 87.28 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 86.99 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 86.98 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 86.87 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 86.48 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 86.46 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 86.37 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 86.25 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 85.88 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 85.61 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 85.31 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 83.56 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 83.2 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 82.59 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 80.99 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 80.09 |
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=97.34 E-value=0.0025 Score=50.16 Aligned_cols=39 Identities=10% Similarity=-0.036 Sum_probs=30.2
Q ss_pred CCCeEEEEeCCHHHHHHHHHhcccC--CCCCceeeeCCCCC
Q 010628 319 IMPAAFVSFNSRWGAAVCAQTQQTR--NPTLWLTEWASEPR 357 (505)
Q Consensus 319 ~~~~AFVtF~s~~~a~~a~q~~~~~--~~~~~~v~~APeP~ 357 (505)
..|.|||+|.+..+|..|.+.+... +...+.|+.|.++.
T Consensus 46 ~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~V~~a~~~~ 86 (95)
T 2dnz_A 46 SKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERL 86 (95)
T ss_dssp CCSEEEEEESCHHHHHHHHHHHTTCCSSSSCCEEEESSCCC
T ss_pred eeeEEEEEECCHHHHHHHHHHhCCCeeCCcEEEEEEccccc
Confidence 3589999999999999999976654 34567788776544
|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 505 | |||
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.59 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 97.51 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 97.5 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.49 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 97.49 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 97.41 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 97.35 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 97.31 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.31 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 97.3 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 97.27 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.24 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 97.2 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.2 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 97.19 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 97.19 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 97.18 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 97.11 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.11 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 97.09 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 97.08 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 97.03 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 97.01 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 97.0 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 96.97 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 96.97 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 96.92 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.91 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.9 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 96.9 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.87 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 96.85 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 96.84 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.84 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 96.8 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.65 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 96.62 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 96.62 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 96.62 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 96.6 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 96.59 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 96.53 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 96.51 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 96.51 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 96.5 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 96.49 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 96.48 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 96.48 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 96.47 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 96.43 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 96.35 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 96.34 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 96.34 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 96.32 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 96.27 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 96.21 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 96.19 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 96.17 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 96.02 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 95.95 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 95.93 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 95.9 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 95.82 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 95.8 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 95.6 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 94.85 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 94.64 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 94.38 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 94.33 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 94.1 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 94.07 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 93.89 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 93.1 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 92.19 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 91.29 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 89.32 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 89.22 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 88.81 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 88.37 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 88.25 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 88.01 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 86.4 |
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Sex-lethal protein species: Drosophila melanogaster [TaxId: 7227]
Probab=97.59 E-value=0.00014 Score=54.34 Aligned_cols=35 Identities=17% Similarity=0.147 Sum_probs=27.9
Q ss_pred CCeEEEEeCCHHHHHHHHHhcccC--CCCCceeeeCC
Q 010628 320 MPAAFVSFNSRWGAAVCAQTQQTR--NPTLWLTEWAS 354 (505)
Q Consensus 320 ~~~AFVtF~s~~~a~~a~q~~~~~--~~~~~~v~~AP 354 (505)
.|.|||+|.+..+|..|.+.+... ....++++.|.
T Consensus 44 ~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~a~ 80 (82)
T d1b7fa1 44 YGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR 80 (82)
T ss_dssp CSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred cccceEEECCHHHHHHHHHHhCCCEECCEEEEEEEcC
Confidence 589999999999999999987654 33456777763
|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|