Citrus Sinensis ID: 010634

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVATD
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHccccccccccccccccccccccHcccccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHccccccccEEEEEcccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
MATLADIGVSAALNILGAFIFLIAFAILRlqpfndrvyfpkwylkglrdspthggaFVRKFVNLDFRSYIRFLNwmpealkmpepeliehaglDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKIsnvtasdidklsisnvplksqRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVasekrrpdqftvlvrnvppdpdesVSELVEHFFlvnhpnhyltHQVVVNANKLAKLVKKKKKLQNWLDYYQLKysrnnskrpmmktgflglwgekvdgidYHISEIEKLSKEIAEERervvsdpkaimPAAFVSFNSRWGAAVCAqtqqtrnptlwltewaseprdvywqnlaipyvSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVATD
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISnvtasdidklsisnvPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFvasekrrpdqftvLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLkysrnnskrpmmKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSaneyvatd
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQvvvnanklaklvkkkkklQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAfffltfffMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVATD
****ADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRN********VSELVEHFFLVNHPNHYLTHQVVVNANKL************WLDYYQLKYSR******MMKTGFLGLWGEKVDGIDYHISEIEKLSKEI******VVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFL***********
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLK********************FRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSA*******
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVATD
**TLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGL***************NLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSA*******
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGxxxxxxxxxxxxxxxxxxxxxVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVATD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query505 2.2.26 [Sep-21-2011]
Q09766 871 Uncharacterized membrane yes no 0.792 0.459 0.245 1e-23
Q09809 793 Uncharacterized membrane no no 0.807 0.514 0.221 6e-23
Q12252 991 Phosphate metabolism prot yes no 0.879 0.448 0.241 4e-19
Q06538 782 Uncharacterized membrane no no 0.801 0.517 0.207 1e-18
Q03516 953 Uncharacterized protein R no no 0.861 0.456 0.226 1e-16
Q91YT8 804 Transmembrane protein 63A yes no 0.788 0.495 0.224 7e-16
Q5T3F8 832 Transmembrane protein 63B yes no 0.726 0.441 0.216 5e-15
O94886 807 Transmembrane protein 63A no no 0.788 0.493 0.222 8e-15
Q3TWI9 832 Transmembrane protein 63B no no 0.732 0.444 0.215 1e-14
Q5R826 807 Transmembrane protein 63A yes no 0.788 0.493 0.220 3e-14
>sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 Back     alignment and function desciption
 Score =  111 bits (277), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 111/452 (24%), Positives = 194/452 (42%), Gaps = 52/452 (11%)

Query: 80  LKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNV 139
           +K  E  LI++AG+D   ++R       + +   LV + +L+PVN TN           V
Sbjct: 71  VKRSETYLIQYAGVDGYFFIRYLFTFGALCILGCLVLFPILLPVNATN----------GV 120

Query: 140 TASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKE--YEKVANLRLQFVASEKR 197
                D LS SNV     RF+ HV +++ F  +T +++ +E  Y  +    +Q       
Sbjct: 121 GEKGFDILSFSNVK-NHNRFYAHVFLSWLFFGFTIFIIYRELRYYVIFRHAMQSSGLYNN 179

Query: 198 RPDQFTVLVRNVPP---DPDESVSEL---VEHFFLV-----------------NHPNHYL 234
            P   T+L+  +P    + +E++ EL      F  V                 N     L
Sbjct: 180 LPSSSTMLLTELPNSVLNDEETLHELFPNASEFTCVRDLKKLEKKVKKRSDLGNKYESTL 239

Query: 235 THQVVVNANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYH 294
              +  +  K  KLVKK K L + LDY     +    KRP  +  FL   G+KVD IDY 
Sbjct: 240 NSLINKSVKKHNKLVKKHKPLPSTLDY-----TAYVKKRPTHRLKFL--IGKKVDTIDYC 292

Query: 295 ISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQ----TQQTRNPTLWLT 350
              I +L  E+ ++ +  + + K +  + F+ F S+       Q    +++ R       
Sbjct: 293 RDTIAELD-EVVDKLQTSLEERKKV-GSVFIRFRSQTDLQTAYQAFLYSKKFRKYRFGRA 350

Query: 351 EWASEPRDVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVP 410
                P D+ W NL +   +   ++ I       +  F+  P+A+V   +++  + + V 
Sbjct: 351 LVGIAPEDIVWSNLDLSMYTRRGKKTISNTILTLMIIFWAFPVAVVGCISNVNYLIEKVH 410

Query: 411 FLKPV--IEAKFIKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRY 468
           FLK +  +  K +  +I G LP +AL + +  +P  +  + KF G +++  +E      Y
Sbjct: 411 FLKFIDHMPPKLL-GIITGILPSVALSILMSLVPPFIKFLGKFGGALTVQEIENYCQNWY 469

Query: 469 YLFNFVNVFLGSIIAGTAFEQLNSFLKQSANE 500
           Y F  V VFL + +   A   +   +K+ A+ 
Sbjct: 470 YAFQVVQVFLVTTMTSAATSAVVQVIKEPASS 501

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q09809|YAB9_SCHPO Uncharacterized membrane protein C2G11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 Back     alignment and function description
>sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 Back     alignment and function description
>sp|Q06538|YL241_YEAST Uncharacterized membrane protein YLR241W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR241W PE=1 SV=1 Back     alignment and function description
>sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 Back     alignment and function description
>sp|Q91YT8|TM63A_MOUSE Transmembrane protein 63A OS=Mus musculus GN=Tmem63a PE=2 SV=1 Back     alignment and function description
>sp|Q5T3F8|TM63B_HUMAN Transmembrane protein 63B OS=Homo sapiens GN=TMEM63B PE=1 SV=1 Back     alignment and function description
>sp|O94886|TM63A_HUMAN Transmembrane protein 63A OS=Homo sapiens GN=TMEM63A PE=2 SV=3 Back     alignment and function description
>sp|Q3TWI9|TM63B_MOUSE Transmembrane protein 63B OS=Mus musculus GN=Tmem63b PE=1 SV=1 Back     alignment and function description
>sp|Q5R826|TM63A_PONAB Transmembrane protein 63A OS=Pongo abelii GN=TMEM63A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query505
224115866 772 predicted protein [Populus trichocarpa] 0.998 0.652 0.837 0.0
343157312 772 early-responsive to dehydration-related 0.990 0.647 0.832 0.0
225444327 766 PREDICTED: uncharacterized membrane prot 0.986 0.650 0.794 0.0
225444325 771 PREDICTED: uncharacterized membrane prot 0.986 0.645 0.794 0.0
255554789 773 conserved hypothetical protein [Ricinus 0.994 0.649 0.845 0.0
449455385 773 PREDICTED: uncharacterized membrane prot 0.990 0.646 0.816 0.0
62319788 771 hypothetical protein [Arabidopsis thalia 0.990 0.648 0.8 0.0
42567026 771 early-responsive to dehydration stress-r 0.990 0.648 0.8 0.0
449519707 773 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.990 0.646 0.816 0.0
224099861 771 predicted protein [Populus trichocarpa] 0.990 0.648 0.816 0.0
>gi|224115866|ref|XP_002317144.1| predicted protein [Populus trichocarpa] gi|222860209|gb|EEE97756.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/504 (83%), Positives = 464/504 (92%)

Query: 1   MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK 60
           MATL DI VS ALN+LGAFIFL+AFAILR+QPFNDRVYFPKWYLKGLR S +H GAF R+
Sbjct: 1   MATLGDIAVSGALNLLGAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSASHSGAFARR 60

Query: 61  FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL 120
            VNLDFRSY RFLNWMPEALKMPEPELI+HAGLDSAVYLRIYL+GLKIFVPIA +AW++L
Sbjct: 61  IVNLDFRSYTRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAIL 120

Query: 121 VPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKE 180
           VPVN+TNDTL+ A  +SNVTASDIDKLSISNVPLKSQRFW H+VMAYAFTFWTCYVLLKE
Sbjct: 121 VPVNYTNDTLEKAQLVSNVTASDIDKLSISNVPLKSQRFWAHIVMAYAFTFWTCYVLLKE 180

Query: 181 YEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQVVV 240
           YEK+A++RLQF++SE RRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHP+HYL HQVV 
Sbjct: 181 YEKIASMRLQFLSSEGRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPHHYLIHQVVC 240

Query: 241 NANKLAKLVKKKKKLQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEK 300
           NANKLA LVKKKK  QNWLDYYQLKY RN S+RP+ KTGFLGLWGEKVD ID+HISEI+K
Sbjct: 241 NANKLASLVKKKKSKQNWLDYYQLKYDRNQSQRPLKKTGFLGLWGEKVDAIDHHISEIKK 300

Query: 301 LSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVY 360
           LS+EI EERE+V+ DPK+IMPAAFVSF +RWGAAVCAQTQQ+RNPTLWLTEWA EPRDVY
Sbjct: 301 LSEEIEEEREKVLKDPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVY 360

Query: 361 WQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKF 420
           W+NLAIPY+SLSVRRLI+GVAFFFLTFFFMIPIA VQ+ ASIEGIEK  PFLKP+IE KF
Sbjct: 361 WENLAIPYMSLSVRRLIIGVAFFFLTFFFMIPIASVQALASIEGIEKKAPFLKPIIEIKF 420

Query: 421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGS 480
           IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGF+S+SSLERR+ATRYY+F  +NVFLGS
Sbjct: 421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFLSISSLERRSATRYYIFLIINVFLGS 480

Query: 481 IIAGTAFEQLNSFLKQSANEYVAT 504
           I+AG AFEQLNSF+ QSANE   T
Sbjct: 481 ILAGAAFEQLNSFINQSANEIPKT 504

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|343157312|gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica] Back     alignment and taxonomy information
>gi|225444327|ref|XP_002264591.1| PREDICTED: uncharacterized membrane protein C24H6.13 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444325|ref|XP_002264502.1| PREDICTED: uncharacterized membrane protein C24H6.13 isoform 1 [Vitis vinifera] gi|302144095|emb|CBI23200.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554789|ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis] gi|223542277|gb|EEF43819.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449455385|ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|62319788|dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42567026|ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|145333700|ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512288|ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512292|ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|186512296|ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|334186802|ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|53828549|gb|AAU94384.1| At4g22120 [Arabidopsis thaliana] gi|57444911|gb|AAW50707.1| At4g22120 [Arabidopsis thaliana] gi|332659154|gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659155|gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659156|gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659157|gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659158|gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] gi|332659159|gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449519707|ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224099861|ref|XP_002334434.1| predicted protein [Populus trichocarpa] gi|222872071|gb|EEF09202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query505
TAIR|locus:2120673 771 AT4G22120 [Arabidopsis thalian 0.998 0.653 0.748 5.8e-208
TAIR|locus:2027119 769 AT1G62320 "AT1G62320" [Arabido 0.992 0.651 0.716 4.2e-198
TAIR|locus:2008860 771 AT1G11960 "AT1G11960" [Arabido 0.996 0.652 0.720 8.7e-198
TAIR|locus:2134882 772 AT4G04340 [Arabidopsis thalian 0.998 0.652 0.708 1.1e-195
TAIR|locus:2089850 756 AT3G21620 "AT3G21620" [Arabido 0.992 0.662 0.692 4.6e-192
TAIR|locus:2130130 761 AT4G15430 "AT4G15430" [Arabido 0.996 0.660 0.666 5.2e-184
TAIR|locus:2140210 785 AT4G02900 [Arabidopsis thalian 0.992 0.638 0.640 3.1e-177
TAIR|locus:2031735 806 AT1G32090 "AT1G32090" [Arabido 0.994 0.622 0.576 2.2e-160
TAIR|locus:2102117 703 HYP1 "hypothetical protein 1" 0.815 0.586 0.308 1e-59
TAIR|locus:2204227 724 ERD4 "early-responsive to dehy 0.932 0.650 0.300 8.6e-56
TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2011 (713.0 bits), Expect = 5.8e-208, P = 5.8e-208
 Identities = 377/504 (74%), Positives = 430/504 (85%)

Query:     1 MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK 60
             MATL DIGVSA +NIL AF+F I FA+LRLQPFNDRVYF KWYLKGLR SP  GGAF ++
Sbjct:     1 MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR 60

Query:    61 FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVL 120
             FVNLDFRSY++FLNWMPEALKMPEPELI+HAGLDS VYLRIY +GLKIF PIA++AW+VL
Sbjct:    61 FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL 120

Query:   121 VPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWTHVVMAYAFTFWTCYVLLKE 180
             VPVNWTN+TL++A ++ NVT+SDIDKLS+SN+P  S RFWTH+VMAYAFT WTCYVL+KE
Sbjct:   121 VPVNWTNNTLEMAKQLRNVTSSDIDKLSVSNIPEYSMRFWTHIVMAYAFTIWTCYVLMKE 180

Query:   181 YEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNHYLTHQXXX 240
             YE +AN+RLQFVASE RRPDQFTVLVRNVPPD DESVSELVEHFFLVNHP+HYLTHQ   
Sbjct:   181 YETIANMRLQFVASEARRPDQFTVLVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVC 240

Query:   241 XXXXXXXXXXXXXXXQNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEK 300
                            QNWLDYYQLKY+RNNS+R M+K GFLGLWG+KVD I+++I+EI+K
Sbjct:   241 NANKLADLVKKKKKLQNWLDYYQLKYARNNSQRIMVKLGFLGLWGQKVDAIEHYIAEIDK 300

Query:   301 LSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVY 360
             +SKEI++ERE VV+DPKAIMPAAFVSF +RW AAVCAQTQQTRNPT WLTEWA EPRDV+
Sbjct:   301 ISKEISKEREEVVNDPKAIMPAAFVSFKTRWAAAVCAQTQQTRNPTQWLTEWAPEPRDVF 360

Query:   361 WQNLAIPYVSLSVRRLIMGVAXXXXXXXXMIPIAIVQSFASIEGIEKAVPFLKPVIEAKF 420
             W NLAIPYVSL+VRRLIM VA        ++PIA VQS A+IEGI KA PFLK +++ KF
Sbjct:   361 WSNLAIPYVSLTVRRLIMHVAFFFLTFFFIVPIAFVQSLATIEGIVKAAPFLKFIVDDKF 420

Query:   421 IKSVIQGFLPGIALKLFLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGS 480
             +KSVIQGFLPGIALKLFL FLP+ILMIMSKFEGF S+SSLERRAA RYY+FN VNVFL S
Sbjct:   421 MKSVIQGFLPGIALKLFLAFLPSILMIMSKFEGFTSISSLERRAAFRYYIFNLVNVFLAS 480

Query:   481 IIAGTAFEQLNSFLKQSANEYVAT 504
             +IAG AFEQLNSFL QSAN+   T
Sbjct:   481 VIAGAAFEQLNSFLNQSANQIPKT 504
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0016020 "membrane" evidence=IEA
TAIR|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204227 ERD4 "early-responsive to dehydration 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query505
pfam02714 325 pfam02714, DUF221, Domain of unknown function DUF2 4e-59
COG5594 827 COG5594, COG5594, Uncharacterized integral membran 5e-45
pfam13967151 pfam13967, RSN1_TM, Late exocytosis, associated wi 5e-45
>gnl|CDD|190398 pfam02714, DUF221, Domain of unknown function DUF221 Back     alignment and domain information 
 Score =  197 bits (504), Expect = 4e-59
 Identities = 63/175 (36%), Positives = 96/175 (54%), Gaps = 1/175 (0%)

Query: 323 AFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRRLIMGVAF 382
           AFV+F S+  A + AQ  Q  NP  W T  A EPRD+ W+NL++      +RRLI+ +  
Sbjct: 1   AFVTFKSQAAAQMAAQALQHHNPLKWPTYLAPEPRDIIWENLSLSRWERWLRRLIVNLLL 60

Query: 383 FFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEA-KFIKSVIQGFLPGIALKLFLIFL 441
           F L  F+ IP+A V   +++E + K  PFLK +++    +  ++ G LP + L L +  L
Sbjct: 61  FLLIIFWAIPVAFVGLLSNLETLTKVWPFLKWILDLPPVLLGLVTGLLPTLLLSLLMALL 120

Query: 442 PTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQ 496
           P IL  +SK +G  S S +E    ++Y+ F  VNVFL   +A TA   +   +  
Sbjct: 121 PIILRFLSKLQGHPSRSDVELSVQSKYFAFLVVNVFLVVTLASTASSLITEIIDN 175

This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length. Length = 325
>gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 505
COG5594 827 Uncharacterized integral membrane protein [Functio 100.0
KOG1134 728 consensus Uncharacterized conserved protein [Gener 100.0
PF02714 325 DUF221: Domain of unknown function DUF221; InterPr 100.0
PF13967157 RSN1_TM: Late exocytosis, associated with Golgi tr 100.0
PF1470385 DUF4463: Domain of unknown function (DUF4463) 99.02
PF04547 452 Anoctamin: Calcium-activated chloride channel; Int 97.45
KOG2513 647 consensus Protein required for meiotic chromosome 97.02
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 96.79
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 95.8
PLN03120260 nucleic acid binding protein; Provisional 95.6
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 95.59
PLN03121243 nucleic acid binding protein; Provisional 95.55
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 95.45
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.36
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 94.82
KOG0122270 consensus Translation initiation factor 3, subunit 94.7
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 94.14
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 92.74
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 92.32
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 91.99
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 91.88
KOG2514 861 consensus Uncharacterized conserved protein [Funct 90.76
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 90.71
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 89.28
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 89.16
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 88.77
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 88.75
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 87.46
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 86.76
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 85.62
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 85.3
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 83.12
smart0036170 RRM_1 RNA recognition motif. 82.35
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 81.92
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 81.59
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 81.2
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 80.05
>COG5594 Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-86  Score=686.89  Aligned_cols=476  Identities=26%  Similarity=0.445  Sum_probs=426.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCccccccccccCCC-CCCCCCCcccccccccccccccccccchhhhcC
Q 010634            3 TLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLR-DSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALK   81 (505)
Q Consensus         3 ~~~~~~~~l~~~~~~~~~~~~~F~~lR~~~~~~~iY~pr~~~~~~~-~~p~~~~~~~~~~~~l~~~~~~~~~~Wi~~~~~   81 (505)
                      +.++++|+++++..++++++++|++||+|  ++++|+||+..++.+ +.|              ++.|+|+|||+.++++
T Consensus        20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~~~~P--------------~~~~ss~~gWl~~L~~   83 (827)
T COG5594          20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQNECLP--------------EPNPSSYWGWLEPLVK   83 (827)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCCcccC--------------CCCccchHHHHHHHHh
Confidence            47899999999999999999999999986  899999999877643 223              3567899999999999


Q ss_pred             CChhHHHHhcCccHHHHHHHHHHHHHHHHHHHHHHHhhhcceeeeCCCccccccccCcCCCccccccccCcCCCCchHHH
Q 010634           82 MPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQRFWT  161 (505)
Q Consensus        82 ~~~~~i~~~~GlDa~~~lrfl~~~~~~f~~~~~~~~~iLlPvn~~~~~~~~~~~~~~~~~~~l~~~TisNv~~~s~~lw~  161 (505)
                      ++|+.+++++|+|||+||||+|||+++++++|+++++||+|+|++.++..+..   .-..++++++|++|+.+ ++++|+
T Consensus        84 i~d~~~l~~aGlD~y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~gn---~~s~s~l~~Ls~~Nv~~-~n~~~a  159 (827)
T COG5594          84 IPDEFLLQYAGLDGYFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATNGN---SDSESGLDKLSISNVSP-SNRLYA  159 (827)
T ss_pred             CCHHHHHHHcCcchhhHHHHHHHHHHHHHHHHHHHhHEeeeeeecccccccCC---ccchhhhhHhhhhcccC-CCceee
Confidence            99999999999999999999999999999999999999999998875443210   11358999999999986 789999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC---------CCCcceEEEEcCCCCCCccHHHHHHHhhhhcCCCc
Q 010634          162 HVVMAYAFTFWTCYVLLKEYEKVANLRLQFVASEKR---------RPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPNH  232 (505)
Q Consensus       162 h~i~~~l~~~~~~~~l~~e~~~~~~~R~~~l~~~~~---------~~~~~TVlV~~IP~~~~~~~~~~l~~~f~~~~p~~  232 (505)
                      |++..|++.++++|.+++|++.|+.+||++++++..         +.++||+++++||.+...  .+.+.++|+++..++
T Consensus       160 Hvf~~~~f~~~vlfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~--~e~L~~~~~kl~~~~  237 (827)
T COG5594         160 HVFLSWFFFGYVLFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS--DEELKELFDKLKVGE  237 (827)
T ss_pred             eeehhHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC--chhHHHHHhhcCeee
Confidence            999999999999999999999999999999998752         348999999999997633  245888999988888


Q ss_pred             eeeeEeEecchhHHHHHHHHHHHHHHHHHHHH-------hh-----hc--------------------CCCCCCcccccc
Q 010634          233 YLTHQVVVNANKLAKLVKKKKKLQNWLDYYQL-------KY-----SR--------------------NNSKRPMMKTGF  280 (505)
Q Consensus       233 v~~v~i~~d~~~L~~l~~~r~~~~~~le~~~~-------k~-----~k--------------------~~~~rp~~k~~~  280 (505)
                      +.+..+|||.+.|++++++|++..+++|.+.+       |.     .|                    ...+||++|.+-
T Consensus       238 i~~~~l~~~~~~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k  317 (827)
T COG5594         238 IDSDVLCRDLGTLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKK  317 (827)
T ss_pred             eccchhhhhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhh
Confidence            98999999999999999999999999884321       11     01                    013589888765


Q ss_pred             c--cCCCCcccHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCeEEEEeCCHHHHHHHHHhcccCCCCCce-eeeCCCCC
Q 010634          281 L--GLWGEKVDGIDYHISEIEKLSKEIAEERERVVSDPKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWL-TEWASEPR  357 (505)
Q Consensus       281 ~--~~~g~kvdai~~~~~~l~~l~~~I~~~~~~~~~~~~~~~~~AFVtF~s~~~a~~a~q~~~~~~~~~~~-v~~APeP~  357 (505)
                      .  ++.|+|||+|||+++++.+++++|++.|+......  ++++|||||+|+..||+|+|.+.++++.... ++.||+|+
T Consensus       318 ~~~~i~gKkVdaI~y~s~~l~~l~~~i~~~r~~~~~~t--~~~~~FItFkSq~~Aq~~aQ~~~~sr~~~~~~v~iapaPn  395 (827)
T COG5594         318 LNKGIFGKKVDAIDYYSAKLTKLDAEIENARKSLYENT--PTKSGFITFKSQASAQIAAQSQIYSRVLGKLKVEIAPAPN  395 (827)
T ss_pred             hhhhhccceecHHHHHHHHHHHHHHHHHHHHhCccccC--ccccEEEEEehhHHHHHHHHhhhhhhhhcceeeeecCCcc
Confidence            5  67899999999999999999999999999865543  4679999999999999999999999987766 99999999


Q ss_pred             CeecCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhHHhhcccchhh-hhchhHHHHHHhhhHHHHHHH
Q 010634          358 DVYWQNLAIPYVSLSVRRLIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPV-IEAKFIKSVIQGFLPGIALKL  436 (505)
Q Consensus       358 DIiW~NL~~s~~~r~~R~~~~~~~~~~liif~~iPva~v~~l~~~~~l~~~~p~l~~~-~~~~~~~~~i~~~lP~l~l~~  436 (505)
                      ||+|+|+..++++|..+++.+++++++++++|++|||+|+.++|+++|++.+||++.+ .+.|+++++++|+||++++.+
T Consensus       396 Di~W~Nl~ls~~~r~~k~~~~ni~~il~II~w~~pVa~v~~i~Nl~~l~~~~p~l~~il~~~~~l~~iltglLptv~~~~  475 (827)
T COG5594         396 DIIWDNLRLSRKERLFKRISANILFILLIILWAFPVAFVGTISNLNTLSSLWPFLKFILKDPPFLAGILTGLLPTVALSL  475 (827)
T ss_pred             ccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHhhhhHHHHHHHhccHHHHHHHHhhhhHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999 566799999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCCcchhHHHHHHHhHHHHHHHHHHHHHHHhhHhHHHHHHHHHhcccccccC
Q 010634          437 FLIFLPTILMIMSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANEYVA  503 (505)
Q Consensus       437 ~~~llP~ii~~ls~~eg~~T~S~~~~s~~~k~f~fl~~n~flv~~i~~s~~~~l~~~~~~p~~~i~~  503 (505)
                      ++.++|+++++++++||..|+|+.|+.++.|||.|+|+|+|+|++++|++.+.+.+++++| .||++
T Consensus       476 l~~ivP~fir~Ls~~qG~~S~se~E~~~~~k~~~f~fv~~FlV~Tl~s~fss~v~~~~ke~-~s~~~  541 (827)
T COG5594         476 LMSIVPYFIRWLSYMQGLVSYSEEEIYVQNKYFAFLFVNLFLVVTLASSFSSIVWSLLKEP-TSIMT  541 (827)
T ss_pred             HHHHhHHHHHHHHHhcCccchHHHHHHHHhhhhhheeeeehheeeehhHHHHHHHHHhcCh-HhHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999 78875

>KOG1134 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length Back     alignment and domain information
>PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport Back     alignment and domain information
>PF14703 DUF4463: Domain of unknown function (DUF4463) Back     alignment and domain information
>PF04547 Anoctamin: Calcium-activated chloride channel; InterPro: IPR007632 This family contains the anoctamin/TMEM16 proteins which are thought to be calcium-dependent chloride channel [] Back     alignment and domain information
>KOG2513 consensus Protein required for meiotic chromosome segregation [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2514 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query505
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 48.3 bits (114), Expect = 5e-06
 Identities = 44/281 (15%), Positives = 93/281 (33%), Gaps = 77/281 (27%)

Query: 72  FLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAWSVLVPVNW---TND 128
            L +    L     +L       +    R+ +I   I   +A   W      NW     D
Sbjct: 307 LLKY----LDCRPQDLPREVLTTNP--RRLSIIAESIRDGLAT--WD-----NWKHVNCD 353

Query: 129 TLDVAVKIS--NVTASDI----DKLSI----SNVPLKSQRFWTHVVMAYAFTFWTCYVLL 178
            L   ++ S   +  ++     D+LS+    +++P          +++     W   V+ 
Sbjct: 354 KLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI--------LLS---LIW-FDVIK 401

Query: 179 KEYEKVANLRLQFVASEKRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHP--NHYLTH 236
            +   V N   ++   EK                P ES   +   +  +     N Y  H
Sbjct: 402 SDVMVVVNKLHKYSLVEK---------------QPKESTISIPSIYLELKVKLENEYALH 446

Query: 237 QVVVNANKLAKLVKKKKKLQNWLDYY-------QLKYSRNNSKRPMMKTGFLGL-W-GEK 287
           + +V+   + K       +  +LD Y        LK   +  +  + +  FL   +  +K
Sbjct: 447 RSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQK 506

Query: 288 V--DGIDYH--------ISEIEKLSKEIAE---ERERVVSD 315
           +  D   ++        + +++     I +   + ER+V+ 
Sbjct: 507 IRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNA 547
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query505
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.34
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 97.31
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.28
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.17
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.16
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.11
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.09
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.02
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 96.99
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 96.99
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 96.97
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 96.97
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 96.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 96.95
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 96.93
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 96.91
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 96.9
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.9
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 96.85
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 96.83
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.83
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.8
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.78
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 96.78
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.76
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.74
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 96.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 96.72
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 96.72
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 96.72
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 96.69
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 96.69
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 96.69
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.68
2div_A99 TRNA selenocysteine associated protein; structural 96.66
2cqd_A116 RNA-binding region containing protein 1; RNA recog 96.65
2la6_A99 RNA-binding protein FUS; structural genomics, nort 96.64
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.64
2cph_A107 RNA binding motif protein 19; RNA recognition moti 96.64
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.63
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.61
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 96.6
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.58
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 96.58
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 96.57
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.57
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 96.57
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 96.56
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 96.56
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 96.56
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 96.53
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 96.52
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.52
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 96.52
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.5
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.49
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.49
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.47
2cpj_A99 Non-POU domain-containing octamer-binding protein; 96.45
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.42
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 96.41
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 96.4
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.39
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 96.37
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.36
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 96.36
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.35
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.34
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.32
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.31
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 96.28
1x4e_A85 RNA binding motif, single-stranded interacting pro 96.25
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 96.22
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 96.22
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 96.22
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 96.2
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 96.18
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.17
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.17
3n9u_C156 Cleavage and polyadenylation specificity factor S; 96.15
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 96.14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.13
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 96.13
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 96.13
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 96.12
1x5o_A114 RNA binding motif, single-stranded interacting pro 96.11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 96.09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.06
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 96.06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 96.05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 96.04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 96.03
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.03
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 96.01
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 96.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.0
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 95.99
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 95.99
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 95.98
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 95.97
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 95.94
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 95.94
2f3j_A177 RNA and export factor binding protein 2; RRM domai 95.94
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.93
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 95.91
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 95.89
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 95.89
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 95.89
2dis_A109 Unnamed protein product; structural genomics, RRM 95.87
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 95.86
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 95.85
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 95.84
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 95.84
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 95.82
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 95.81
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 95.8
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 95.76
2dnl_A114 Cytoplasmic polyadenylation element binding protei 95.74
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 95.74
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 95.71
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 95.7
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 95.67
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 95.65
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 95.64
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 95.63
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.62
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 95.62
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 95.59
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 95.55
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 95.53
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 95.52
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 95.48
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 95.46
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 95.45
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 95.38
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 95.32
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 95.3
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 95.29
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 95.27
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 95.22
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 95.2
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 95.17
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 95.16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 95.12
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 95.09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 95.08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 94.92
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 94.67
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 94.6
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 94.59
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 94.36
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 94.26
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 94.19
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 93.89
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 93.78
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 93.7
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 93.68
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 93.42
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 93.4
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 93.33
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 92.98
2dit_A112 HIV TAT specific factor 1 variant; structural geno 92.77
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 92.0
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 91.33
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 91.27
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 91.11
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 90.86
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 90.74
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 90.28
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 90.13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 89.08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 88.71
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 88.11
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 87.28
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 86.99
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 86.98
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 86.87
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 86.48
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 86.46
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 86.37
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 86.25
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 85.88
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 85.61
1x5p_A97 Negative elongation factor E; structure genomics, 85.31
2krb_A81 Eukaryotic translation initiation factor 3 subunit 83.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 83.2
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 82.59
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 80.99
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 80.09
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=97.34  E-value=0.0025  Score=50.16  Aligned_cols=39  Identities=10%  Similarity=-0.036  Sum_probs=30.2

Q ss_pred             CCCeEEEEeCCHHHHHHHHHhcccC--CCCCceeeeCCCCC
Q 010634          319 IMPAAFVSFNSRWGAAVCAQTQQTR--NPTLWLTEWASEPR  357 (505)
Q Consensus       319 ~~~~AFVtF~s~~~a~~a~q~~~~~--~~~~~~v~~APeP~  357 (505)
                      ..|.|||+|.+..+|..|.+.+...  +...+.|+.|.++.
T Consensus        46 ~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~V~~a~~~~   86 (95)
T 2dnz_A           46 SKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERL   86 (95)
T ss_dssp             CCSEEEEEESCHHHHHHHHHHHTTCCSSSSCCEEEESSCCC
T ss_pred             eeeEEEEEECCHHHHHHHHHHhCCCeeCCcEEEEEEccccc
Confidence            3589999999999999999976654  34567788776544
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query505
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.59
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 97.51
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.5
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.49
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.49
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.41
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.35
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.31
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.31
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.3
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.27
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.24
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.2
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.2
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.19
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.19
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.18
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.11
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.11
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.09
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.08
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 97.03
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.01
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.0
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 96.97
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.97
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 96.92
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.91
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.9
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.9
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.87
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 96.85
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 96.84
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.84
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 96.8
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.65
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.62
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 96.62
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 96.62
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.6
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.59
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 96.53
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 96.51
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 96.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.5
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.49
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 96.48
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 96.48
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 96.47
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 96.43
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.35
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 96.34
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 96.34
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 96.32
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 96.27
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 96.21
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 96.19
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 96.17
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.02
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 95.95
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 95.93
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 95.9
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 95.82
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 95.8
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 95.6
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.85
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 94.64
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.38
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 94.33
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 94.1
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 94.07
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 93.89
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 93.1
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 92.19
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 91.29
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 89.32
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 89.22
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 88.81
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 88.37
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 88.25
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 88.01
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 86.4
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]

Probab=97.59  E-value=0.00014  Score=54.34  Aligned_cols=35  Identities=17%  Similarity=0.147  Sum_probs=27.9

Q ss_pred             CCeEEEEeCCHHHHHHHHHhcccC--CCCCceeeeCC
Q 010634          320 MPAAFVSFNSRWGAAVCAQTQQTR--NPTLWLTEWAS  354 (505)
Q Consensus       320 ~~~AFVtF~s~~~a~~a~q~~~~~--~~~~~~v~~AP  354 (505)
                      .|.|||+|.+..+|..|.+.+...  ....++++.|.
T Consensus        44 ~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~a~   80 (82)
T d1b7fa1          44 YGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR   80 (82)
T ss_dssp             CSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred             cccceEEECCHHHHHHHHHHhCCCEECCEEEEEEEcC
Confidence            589999999999999999987654  33456777763
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure