Citrus Sinensis ID: 010640


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
cccccccccccccHHHHHccccccccccEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccCEEccccccEEEEEEEccccccccccccccccccccccccEECcccccHHHHHHHHHHccccEEEECccccEEEEEEHHHHHHHHcccccccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHcccccEEEcHHHcHHHHHHHHHccccEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHccccEEccccccccHHHHHHHHHcccHHHccccccccccccccEEEEccCEEccccccccHHHHHcccccccccccccEEEccccEECccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccEEEEEEccccccccccccccccccccc
**********GFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEA*******RYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inosine-5'-monophosphate dehydrogenase 2 Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.confidentQ9SA34
Inosine-5'-monophosphate dehydrogenase 2 Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.probableE9PU28
Inosine-5'-monophosphate dehydrogenase Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.probableQ84XA3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.205IMP dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FO4, chain A
Confidence level:very confident
Coverage over the Query: 23-112,237-414,428-500
View the alignment between query and template
View the model in PyMOL
Template: 1EEP, chain A
Confidence level:very confident
Coverage over the Query: 23-105,222-403,437-487
View the alignment between query and template
View the model in PyMOL
Template: 4AF0, chain A
Confidence level:very confident
Coverage over the Query: 156-487
View the alignment between query and template
View the model in PyMOL