Citrus Sinensis ID: 010640

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
cccccccccccccHHHHHccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccEEEccccccEEEEEEEccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHHHcccccccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHcccccEEEcHHHcHHHHHHHHHccccEEEEccccccHHHHHHHccccHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHcccHHHccccccccccccccEEEEccEEEccccccccHHHHHcccccccccccccEEEccccEEEccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccEEEEEEccccccccccccccccccccc
cccccccccccccHHHHHHHHcccccccEEEEccccccccccccEEEEEcccEEEcccHHHcccccHcHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHccccccEEEccEEEEEccccHHHHHHHHHHHccccccEEEccccEEEEEEEccccEEEccccccHHHHcccccccEEccccccHHHHHHHHHHcccEcEEEcccccEEEEEEHHHHHHHHHcccHcHHHcccccEEEEEEEEcccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEcHccHHHHHHHHHccccEEEEEcccccEcEEEEEEccccHHHHHHHHHHHHHHHccccEEEcccEEccHHHHHHHHHcccEEEEHHHHcccccccccEEEEEccEEEEEccccHHHHHHccccccHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHcccccEEEEEccccccccccccEEEcccccc
mdfsplpiedgfsadrlfsqgysytyddviflphyidfpidavslstrltrnidlslpcvaspmdtVTEDYMAAAMAALGGIGivhsnctaadQARLVVSAksrrvpifsssldvfkapdgcindandfdgsnyvfvtesgtrrsrilgyvtksdwenlsdnKVKIFDYMrdcssnvsvpanydlgqidevlekndVDFVVLekdgerldvvtredverlkgypnlgkgtvgpdgkwmvgaaigtresDKERLEHLVKAGVNVVVLdssqgnssFQIEMIKYAKKtypeldvigGNVVTMYQAQNLIEAGVDGlrvgmgsgsicttqevcavgrGQATAVYKVSSIaaqsgvpviadggisnsgHIVKALVLGASTVMmgsflagsteapgayvyqngrrvkkyrgmgsleamtkgsdqrylgdkAKLKIAQGVVGavadkgsvlkFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
mdfsplpiedgfsADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVpifsssldvfkapdgcindandfdgsnyvfvtesgtrrsrilgyvtksdwenlsdNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFvvlekdgerldvvtredverlkgypnlgkgtvgpdgkwMVGAAIGTRESDKERLEHLVKAGVNVVvldssqgnssFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAgsteapgayvyQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLevrtgaaqveggvhglvsyekksf
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYmaaamaaLGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
***********FSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRE**KERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGM************RYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGAS*****HDLLRSRTLRLEVRTGAAQVEGGVHGL********
**********GFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEA**********GDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
*****LPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFSPLPIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query505 2.2.26 [Sep-21-2011]
Q9SA34502 Inosine-5'-monophosphate yes no 0.982 0.988 0.768 0.0
P47996503 Inosine-5'-monophosphate no no 0.982 0.986 0.750 0.0
Q84XA3502 Inosine-5'-monophosphate N/A no 0.992 0.998 0.741 0.0
Q54QQ0515 Inosine-5'-monophosphate yes no 0.944 0.926 0.493 1e-126
F6S675512 Inosine-5'-monophosphate yes no 0.976 0.962 0.494 1e-126
E9PU28514 Inosine-5'-monophosphate yes no 0.974 0.957 0.500 1e-126
A0JNA3514 Inosine-5'-monophosphate yes no 0.968 0.951 0.486 1e-125
P12268514 Inosine-5'-monophosphate yes no 0.974 0.957 0.499 1e-125
P20839514 Inosine-5'-monophosphate no no 0.968 0.951 0.486 1e-125
Q07152537 Inosine-5'-monophosphate yes no 0.966 0.908 0.488 1e-125
>sp|Q9SA34|IMDH2_ARATH Inosine-5'-monophosphate dehydrogenase 2 OS=Arabidopsis thaliana GN=At1g16350 PE=2 SV=1 Back     alignment and function desciption
 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/501 (76%), Positives = 437/501 (87%), Gaps = 5/501 (0%)

Query: 8   IEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTV 67
            EDGFSA++LFSQGYSYTYDDVIFLPH+IDF  DAVSLSTRL++ + LS+PCVASPMDTV
Sbjct: 4   FEDGFSAEKLFSQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSKRVPLSIPCVASPMDTV 63

Query: 68  TEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDAN 127
           +E +MAAAMAALGGIGIVH NC    QA ++  AKS +VPI S +  VFK P+  I   +
Sbjct: 64  SESHMAAAMAALGGIGIVHYNCDIDTQASVIRHAKSLQVPIASDA--VFKCPEHQIGSVD 121

Query: 128 DFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNK--VKIFDYMRDCSS-NVSVPANYD 184
           DF  S++VFV+++GT   ++LGYV+KS+W ++ D++  VKI+DYM+ C + +  VP + D
Sbjct: 122 DFGPSSFVFVSQTGTLTPKLLGYVSKSEWSSMKDDQKEVKIYDYMKSCENKDYYVPWDID 181

Query: 185 LGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIG 244
           L +I+ VLE     FVVLEK+GE ++VVT++DVER+KGYP LG GTVG D KWMVGAAIG
Sbjct: 182 LDKIEAVLEDKQKGFVVLEKEGETVNVVTKDDVERVKGYPKLGSGTVGADKKWMVGAAIG 241

Query: 245 TRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQ 304
           TRESDKERLEHLVKAG NVVVLDSSQGNS +Q+EMIKY K TYPELDV+GGNVVTMYQA+
Sbjct: 242 TRESDKERLEHLVKAGANVVVLDSSQGNSIYQLEMIKYVKNTYPELDVVGGNVVTMYQAE 301

Query: 305 NLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSG 364
           NLI+AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVS++AAQ GVPVIADGGISNSG
Sbjct: 302 NLIKAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSTLAAQHGVPVIADGGISNSG 361

Query: 365 HIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGD 424
           HIVKALVLGASTVMMGSFLAGSTEAPGAY Y+NGRRVKKYRGMGSLEAMTKGSDQRYLGD
Sbjct: 362 HIVKALVLGASTVMMGSFLAGSTEAPGAYEYRNGRRVKKYRGMGSLEAMTKGSDQRYLGD 421

Query: 425 KAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVR 484
            AKLKIAQGVVGAVADKGSVLKFIPYTM AVKQGFQDLGASSLQSAH+LLR  TLRLE R
Sbjct: 422 TAKLKIAQGVVGAVADKGSVLKFIPYTMHAVKQGFQDLGASSLQSAHELLRDNTLRLEAR 481

Query: 485 TGAAQVEGGVHGLVSYEKKSF 505
           TGAAQ+EGG+HGLVSYEKKSF
Sbjct: 482 TGAAQIEGGIHGLVSYEKKSF 502
Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 5
>sp|P47996|IMDH1_ARATH Inosine-5'-monophosphate dehydrogenase 1 OS=Arabidopsis thaliana GN=IMPDH PE=2 SV=1 Back     alignment and function description
>sp|Q84XA3|IMDH_VIGUN Inosine-5'-monophosphate dehydrogenase OS=Vigna unguiculata GN=impdh PE=1 SV=1 Back     alignment and function description
>sp|Q54QQ0|IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum GN=impdh PE=1 SV=1 Back     alignment and function description
>sp|F6S675|IMDH1_XENTR Inosine-5'-monophosphate dehydrogenase 1 OS=Xenopus tropicalis GN=impdh1 PE=3 SV=1 Back     alignment and function description
>sp|E9PU28|IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus GN=Impdh2 PE=3 SV=1 Back     alignment and function description
>sp|A0JNA3|IMDH1_BOVIN Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus GN=IMPDH1 PE=2 SV=2 Back     alignment and function description
>sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens GN=IMPDH2 PE=1 SV=2 Back     alignment and function description
>sp|P20839|IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens GN=IMPDH1 PE=1 SV=2 Back     alignment and function description
>sp|Q07152|IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster GN=ras PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query505
255550731503 inosine-5-monophosphate dehydrogenase, p 0.982 0.986 0.762 0.0
449444158496 PREDICTED: inosine-5'-monophosphate dehy 0.982 1.0 0.748 0.0
15219217502 IMP dehydrogenase [Arabidopsis thaliana] 0.982 0.988 0.768 0.0
224109084501 predicted protein [Populus trichocarpa] 0.976 0.984 0.778 0.0
297844558502 hypothetical protein ARALYDRAFT_889025 [ 0.982 0.988 0.762 0.0
21618070503 inosine-5'-monophosphate dehydrogenase, 0.982 0.986 0.752 0.0
15219385503 inosine-5'-monophosphate dehydrogenase [ 0.982 0.986 0.750 0.0
224101315500 predicted protein [Populus trichocarpa] 0.980 0.99 0.769 0.0
75148854502 RecName: Full=Inosine-5'-monophosphate d 0.992 0.998 0.741 0.0
297842729503 hypothetical protein ARALYDRAFT_477114 [ 0.982 0.986 0.760 0.0
>gi|255550731|ref|XP_002516414.1| inosine-5-monophosphate dehydrogenase, putative [Ricinus communis] gi|223544449|gb|EEF45969.1| inosine-5-monophosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/500 (76%), Positives = 435/500 (87%), Gaps = 4/500 (0%)

Query: 8   IEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTV 67
           +EDG+SA++LF+QGYSYTYDDVIFLPHYIDFP DAVSLST L++N+ LS+PCV+SPMDTV
Sbjct: 6   VEDGYSAEKLFNQGYSYTYDDVIFLPHYIDFPTDAVSLSTNLSKNVPLSIPCVSSPMDTV 65

Query: 68  TEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDAN 127
           TE YMA AMAALGGIGI+HSN + + QA +V S KSRRVPI S+   VF +PD  I +  
Sbjct: 66  TESYMATAMAALGGIGIIHSNLSPSHQADMVRSVKSRRVPILSNP--VFMSPDSRILNHF 123

Query: 128 DFDGS-NYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANYDLG 186
           + D +   V VTESG   S+++GYV KSDW  LS+ + K+ DYMR   S + VP +Y++ 
Sbjct: 124 EDDATLPCVLVTESGAANSKVIGYVLKSDWVGLSNKETKLVDYMRTGDSKLYVPWSYEVA 183

Query: 187 QIDEVLEKNDVDFVVLEKDG-ERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGT 245
           QID  L + + DFV+LE +G E +DV+T+E+VER+K YP LGKGTVGPDGKWMVGA+IGT
Sbjct: 184 QIDAYLRQEERDFVLLENEGGEAVDVITKEEVERVKEYPKLGKGTVGPDGKWMVGASIGT 243

Query: 246 RESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQN 305
           RESDKERL+HLVKAG+N VVLDSSQGNS +QIEMI Y KKTYPELDVIGGNVVT+ QAQN
Sbjct: 244 RESDKERLQHLVKAGINAVVLDSSQGNSIYQIEMINYIKKTYPELDVIGGNVVTVNQAQN 303

Query: 306 LIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGH 365
           LI+ GVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGH
Sbjct: 304 LIKTGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGH 363

Query: 366 IVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDK 425
           IVKAL +GASTVMMG FLAGS EAPGAY+YQ+G R+K+YRGMGSLEAMTKGSDQRYLGD 
Sbjct: 364 IVKALTIGASTVMMGGFLAGSIEAPGAYMYQDGCRIKRYRGMGSLEAMTKGSDQRYLGDT 423

Query: 426 AKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRT 485
           AKLKIAQGVVGAV+DKGSVL+F+PYTMQAVKQGFQDLGASSLQSAHDLLRS+TLRLEVRT
Sbjct: 424 AKLKIAQGVVGAVSDKGSVLQFVPYTMQAVKQGFQDLGASSLQSAHDLLRSKTLRLEVRT 483

Query: 486 GAAQVEGGVHGLVSYEKKSF 505
           GAAQVEGGVHGLV YEKK+F
Sbjct: 484 GAAQVEGGVHGLVFYEKKAF 503

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449444158|ref|XP_004139842.1| PREDICTED: inosine-5'-monophosphate dehydrogenase-like [Cucumis sativus] gi|449492992|ref|XP_004159162.1| PREDICTED: inosine-5'-monophosphate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15219217|ref|NP_173085.1| IMP dehydrogenase [Arabidopsis thaliana] gi|14194878|sp|Q9SA34.1|IMDH2_ARATH RecName: Full=Inosine-5'-monophosphate dehydrogenase 2; Short=IMP dehydrogenase 2; Short=IMPD 2; Short=IMPDH 2 gi|4966356|gb|AAD34687.1|AC006341_15 Strong similarity to gb|L34684 inosine monophosphate dehydrogenase (IMPDH) from Arabidopsis thaliana and is a member of the PF|00478 IMP dehydrogenase family [Arabidopsis thaliana] gi|332191320|gb|AEE29441.1| IMP dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224109084|ref|XP_002315077.1| predicted protein [Populus trichocarpa] gi|222864117|gb|EEF01248.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297844558|ref|XP_002890160.1| hypothetical protein ARALYDRAFT_889025 [Arabidopsis lyrata subsp. lyrata] gi|297336002|gb|EFH66419.1| hypothetical protein ARALYDRAFT_889025 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21618070|gb|AAM67120.1| inosine-5'-monophosphate dehydrogenase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15219385|ref|NP_178065.1| inosine-5'-monophosphate dehydrogenase [Arabidopsis thaliana] gi|1352458|sp|P47996.1|IMDH1_ARATH RecName: Full=Inosine-5'-monophosphate dehydrogenase 1; Short=IMP dehydrogenase 1; Short=IMPD 1; Short=IMPDH 1 gi|4835762|gb|AAD30229.1|AC007202_11 Identical to gb|L34684 IMP dehydrogenase (IMPDH) from Arabidopsis thaliana [Arabidopsis thaliana] gi|18087631|gb|AAL58945.1|AF462859_1 At1g79470/T8K14_11 [Arabidopsis thaliana] gi|1100063|gb|AAB41940.1| IMP dehydrogenase [Arabidopsis thaliana] gi|23463051|gb|AAN33195.1| At1g79470/T8K14_11 [Arabidopsis thaliana] gi|332198126|gb|AEE36247.1| inosine-5'-monophosphate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224101315|ref|XP_002312229.1| predicted protein [Populus trichocarpa] gi|222852049|gb|EEE89596.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|75148854|sp|Q84XA3.1|IMDH_VIGUN RecName: Full=Inosine-5'-monophosphate dehydrogenase; Short=IMP dehydrogenase; Short=IMPD; Short=IMPDH gi|28413147|gb|AAO40253.1| inosine monophosphate dehydrogenase [Vigna unguiculata] Back     alignment and taxonomy information
>gi|297842729|ref|XP_002889246.1| hypothetical protein ARALYDRAFT_477114 [Arabidopsis lyrata subsp. lyrata] gi|297335087|gb|EFH65505.1| hypothetical protein ARALYDRAFT_477114 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query505
TAIR|locus:2032775502 AT1G16350 [Arabidopsis thalian 0.980 0.986 0.756 2.9e-199
TAIR|locus:2206365503 AT1G79470 [Arabidopsis thalian 0.982 0.986 0.741 3.1e-193
RGD|735092514 Impdh2 "IMP (inosine 5'-monoph 0.974 0.957 0.491 9.8e-116
UNIPROTKB|P12268514 IMPDH2 "Inosine-5'-monophospha 0.974 0.957 0.489 1.6e-115
UNIPROTKB|F1SKI5514 IMPDH2 "Inosine-5'-monophospha 0.974 0.957 0.489 1.6e-115
UNIPROTKB|E2QTZ9514 IMPDH2 "Inosine-5'-monophospha 0.974 0.957 0.489 2e-115
ZFIN|ZDB-GENE-030219-206539 impdh1b "inosine 5'-phosphate 0.974 0.912 0.479 2e-115
DICTYBASE|DDB_G0283701515 guaB "IMP dehydrogenase" [Dict 0.956 0.937 0.489 6.4e-115
MGI|MGI:109367514 Impdh2 "inosine 5'-phosphate d 0.974 0.957 0.487 1.1e-114
UNIPROTKB|P12269514 IMPDH2 "Inosine-5'-monophospha 0.974 0.957 0.485 3.8e-114
TAIR|locus:2032775 AT1G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1929 (684.1 bits), Expect = 2.9e-199, P = 2.9e-199
 Identities = 378/500 (75%), Positives = 430/500 (86%)

Query:     9 EDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVT 68
             EDGFSA++LFSQGYSYTYDDVIFLPH+IDF  DAVSLSTRL++ + LS+PCVASPMDTV+
Sbjct:     5 EDGFSAEKLFSQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSKRVPLSIPCVASPMDTVS 64

Query:    69 EDYXXXXXXXLGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDAND 128
             E +       LGGIGIVH NC    QA ++  AKS +VPI S +  VFK P+  I   +D
Sbjct:    65 ESHMAAAMAALGGIGIVHYNCDIDTQASVIRHAKSLQVPIASDA--VFKCPEHQIGSVDD 122

Query:   129 FDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNK--VKIFDYMRDCSS-NVSVPANYDL 185
             F  S++VFV+++GT   ++LGYV+KS+W ++ D++  VKI+DYM+ C + +  VP + DL
Sbjct:   123 FGPSSFVFVSQTGTLTPKLLGYVSKSEWSSMKDDQKEVKIYDYMKSCENKDYYVPWDIDL 182

Query:   186 GQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGT 245
              +I+ VLE     FVVLEK+GE ++VVT++DVER+KGYP LG GTVG D KWMVGAAIGT
Sbjct:   183 DKIEAVLEDKQKGFVVLEKEGETVNVVTKDDVERVKGYPKLGSGTVGADKKWMVGAAIGT 242

Query:   246 RESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQN 305
             RESDKERLEHLVKAG NVVVLDSSQGNS +Q+EMIKY K TYPELDV+GGNVVTMYQA+N
Sbjct:   243 RESDKERLEHLVKAGANVVVLDSSQGNSIYQLEMIKYVKNTYPELDVVGGNVVTMYQAEN 302

Query:   306 LIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGH 365
             LI+AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVS++AAQ GVPVIADGGISNSGH
Sbjct:   303 LIKAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSTLAAQHGVPVIADGGISNSGH 362

Query:   366 IVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYLGDK 425
             IVKALVLGASTVMMGSFLAGSTEAPGAY Y+NGRRVKKYRGMGSLEAMTKGSDQRYLGD 
Sbjct:   363 IVKALVLGASTVMMGSFLAGSTEAPGAYEYRNGRRVKKYRGMGSLEAMTKGSDQRYLGDT 422

Query:   426 AKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRT 485
             AKLKIAQGVVGAVADKGSVLKFIPYTM AVKQGFQDLGASSLQSAH+LLR  TLRLE RT
Sbjct:   423 AKLKIAQGVVGAVADKGSVLKFIPYTMHAVKQGFQDLGASSLQSAHELLRDNTLRLEART 482

Query:   486 GAAQVEGGVHGLVSYEKKSF 505
             GAAQ+EGG+HGLVSYEKKSF
Sbjct:   483 GAAQIEGGIHGLVSYEKKSF 502
GO:0003824 "catalytic activity" evidence=IEA
GO:0003938 "IMP dehydrogenase activity" evidence=IEA;ISS
GO:0006177 "GMP biosynthetic process" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
TAIR|locus:2206365 AT1G79470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|735092 Impdh2 "IMP (inosine 5'-monophosphate) dehydrogenase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12268 IMPDH2 "Inosine-5'-monophosphate dehydrogenase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKI5 IMPDH2 "Inosine-5'-monophosphate dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTZ9 IMPDH2 "Inosine-5'-monophosphate dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030219-206 impdh1b "inosine 5'-phosphate dehydrogenase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283701 guaB "IMP dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:109367 Impdh2 "inosine 5'-phosphate dehydrogenase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P12269 IMPDH2 "Inosine-5'-monophosphate dehydrogenase 2" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P12269IMDH2_CRIGR1, ., 1, ., 1, ., 2, 0, 50.49500.97420.9571yesno
P12268IMDH2_HUMAN1, ., 1, ., 1, ., 2, 0, 50.49900.97420.9571yesno
Q8F4Q4IMDH_LEPIN1, ., 1, ., 1, ., 2, 0, 50.44240.95840.9527yesno
Q8CMQ7IMDH_STAES1, ., 1, ., 1, ., 2, 0, 50.36800.86930.8995yesno
Q07152IMDH_DROME1, ., 1, ., 1, ., 2, 0, 50.48820.96630.9087yesno
E9PU28IMDH2_RAT1, ., 1, ., 1, ., 2, 0, 50.50090.97420.9571yesno
O50316IMDH_CHLP81, ., 1, ., 1, ., 2, 0, 50.37870.82170.8400yesno
P47996IMDH1_ARATH1, ., 1, ., 1, ., 2, 0, 50.75090.98210.9860nono
P99106IMDH_STAAN1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q5KP44IMDH_CRYNJ1, ., 1, ., 1, ., 2, 0, 50.46270.97220.9025yesno
Q84XA3IMDH_VIGUN1, ., 1, ., 1, ., 2, 0, 50.74110.99200.9980N/Ano
Q4WHZ9IMDH_ASPFU1, ., 1, ., 1, ., 2, 0, 50.46370.95640.8846yesno
F6S675IMDH1_XENTR1, ., 1, ., 1, ., 2, 0, 50.49400.97620.9628yesno
P38697IMDH2_YEAST1, ., 1, ., 1, ., 2, 0, 50.45960.97620.9426yesno
Q2G0Y7IMDH_STAA81, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q9GZH3IMDH_CAEEL1, ., 1, ., 1, ., 2, 0, 50.38210.97820.9250yesno
Q49UU8IMDH_STAS11, ., 1, ., 1, ., 2, 0, 50.3750.87520.9057yesno
Q6GJQ7IMDH_STAAR1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q6GC82IMDH_STAAS1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q5HRX2IMDH_STAEQ1, ., 1, ., 1, ., 2, 0, 50.36800.86930.8995yesno
P65169IMDH_STAAM1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q8NY70IMDH_STAAW1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
A0JNA3IMDH1_BOVIN1, ., 1, ., 1, ., 2, 0, 50.48620.96830.9513yesno
Q9KGN8IMDH_BACHD1, ., 1, ., 1, ., 2, 0, 50.35220.92070.9587yesno
Q54QQ0IMDH_DICDI1, ., 1, ., 1, ., 2, 0, 50.49300.94450.9262yesno
P24547IMDH2_MOUSE1, ., 1, ., 1, ., 2, 0, 50.49700.97420.9571yesno
Q2YVL6IMDH_STAAB1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q9SA34IMDH2_ARATH1, ., 1, ., 1, ., 2, 0, 50.76840.98210.9880yesno
O67820IMDH_AQUAE1, ., 1, ., 1, ., 2, 0, 50.35570.91080.9387yesno
Q5HIQ7IMDH_STAAC1, ., 1, ., 1, ., 2, 0, 50.37900.88310.9139yesno
Q5RGV1IMDH3_DANRE1, ., 1, ., 1, ., 2, 0, 50.48810.96830.9513yesno
O14344IMDH_SCHPO1, ., 1, ., 1, ., 2, 0, 50.43350.97020.9351yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.2050.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query505
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 0.0
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 0.0
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 0.0
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 0.0
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-126
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 1e-117
PRK07107502 PRK07107, PRK07107, inosine 5-monophosphate dehydr 3e-64
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydr 3e-52
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 7e-43
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 2e-42
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate r 2e-30
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxi 5e-28
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxi 5e-28
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 2e-27
TIGR01306321 TIGR01306, GMP_reduct_2, guanosine monophosphate r 3e-25
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydr 7e-24
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 2e-21
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family 2e-15
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu 4e-15
cd04730236 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD 4e-10
cd04602114 cd04602, CBS_pair_IMPDH_2, This cd contains two ta 7e-10
COG2070336 COG2070, COG2070, Dioxygenases related to 2-nitrop 2e-07
cd04736361 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li 2e-06
pfam03060329 pfam03060, NMO, Nitronate monooxygenase 3e-05
pfam01070302 pfam01070, FMN_dh, FMN-dependent dehydrogenase 4e-05
cd02809299 cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom 9e-05
cd02811326 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimeth 1e-04
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 2e-04
COG1304360 COG1304, idi, Isopentenyl diphosphate isomerase (B 2e-04
pfam00977230 pfam00977, His_biosynth, Histidine biosynthesis pr 3e-04
PRK05437352 PRK05437, PRK05437, isopentenyl pyrophosphate isom 3e-04
pfam00977230 pfam00977, His_biosynth, Histidine biosynthesis pr 0.004
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information 
 Score =  889 bits (2299), Expect = 0.0
 Identities = 374/503 (74%), Positives = 419/503 (83%), Gaps = 6/503 (1%)

Query: 7   PIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDT 66
             EDGFSA++LF+QG SYTYDDVIF P YIDFP DAV LSTRL+RNI LS+PCV+SPMDT
Sbjct: 5   AFEDGFSAEKLFNQGVSYTYDDVIFHPGYIDFPADAVDLSTRLSRNIPLSIPCVSSPMDT 64

Query: 67  VTEDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDA 126
           VTE  MA AMAALGGIGIVH N TA +QA +V  AKSRRV   S    V K+P   I+  
Sbjct: 65  VTESDMAIAMAALGGIGIVHYNNTAEEQAAIVRKAKSRRVGFVSDP--VVKSPSSTISSL 122

Query: 127 NDFDGSN---YVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYMRDCSSNVSVPANY 183
           ++   S     V VTE+GT  S++LGYVTK DW+ ++D + K+ + M      V+ PA  
Sbjct: 123 DELKASRGFSSVCVTETGTMGSKLLGYVTKRDWDFVNDRETKLSEVMTSDDDLVTAPAGI 182

Query: 184 DLGQIDEVLEKNDVDFVVLEKD-GERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAA 242
           DL + + VL+ +    + L  + GE +D+VTR DV+R+KGYP LGK +VG DGK +VGAA
Sbjct: 183 DLEEAEAVLKDSKKGKLPLVNEDGELVDLVTRTDVKRVKGYPKLGKPSVGKDGKLLVGAA 242

Query: 243 IGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQ 302
           IGTRESDKERLEHLVKAGV+VVVLDSSQG+S +Q+EMIKY KKTYPELDVIGGNVVTMYQ
Sbjct: 243 IGTRESDKERLEHLVKAGVDVVVLDSSQGDSIYQLEMIKYIKKTYPELDVIGGNVVTMYQ 302

Query: 303 AQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISN 362
           AQNLI+AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKV+SIAAQ GVPVIADGGISN
Sbjct: 303 AQNLIQAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVASIAAQHGVPVIADGGISN 362

Query: 363 SGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTKGSDQRYL 422
           SGHIVKAL LGASTVMMGSFLAG+TEAPG Y YQ+G RVKKYRGMGSLEAMTKGSDQRYL
Sbjct: 363 SGHIVKALTLGASTVMMGSFLAGTTEAPGEYFYQDGVRVKKYRGMGSLEAMTKGSDQRYL 422

Query: 423 GDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLE 482
           GD AKLKIAQGV GAVADKGSVLKF+PYTMQAVKQGFQDLGASSLQSAH+LLRS TLRLE
Sbjct: 423 GDTAKLKIAQGVSGAVADKGSVLKFVPYTMQAVKQGFQDLGASSLQSAHELLRSGTLRLE 482

Query: 483 VRTGAAQVEGGVHGLVSYEKKSF 505
           VRTGAAQVEGGVHGLVSYEKK+F
Sbjct: 483 VRTGAAQVEGGVHGLVSYEKKAF 505

Length = 505
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial Back     alignment and domain information
>gnl|CDD|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>gnl|CDD|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|224981 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>gnl|CDD|217344 pfam03060, NMO, Nitronate monooxygenase Back     alignment and domain information
>gnl|CDD|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase Back     alignment and domain information
>gnl|CDD|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>gnl|CDD|239205 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|216225 pfam00977, His_biosynth, Histidine biosynthesis protein Back     alignment and domain information
>gnl|CDD|235465 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|216225 pfam00977, His_biosynth, Histidine biosynthesis protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 505
PLN02274505 inosine-5'-monophosphate dehydrogenase 100.0
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 100.0
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 100.0
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 100.0
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 100.0
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 100.0
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 100.0
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 100.0
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 100.0
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 100.0
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 100.0
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 100.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 100.0
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 100.0
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 100.0
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.92
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.9
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 99.9
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 99.89
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 99.89
PLN02979366 glycolate oxidase 99.89
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.88
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 99.88
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.88
PLN02535364 glycolate oxidase 99.87
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 99.87
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 99.86
KOG0538363 consensus Glycolate oxidase [Energy production and 99.86
PRK11197381 lldD L-lactate dehydrogenase; Provisional 99.86
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 99.85
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 99.83
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 99.83
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.82
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 99.78
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 99.77
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 99.75
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 99.75
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 99.73
COG4109432 Predicted transcriptional regulator containing CBS 99.62
COG2524294 Predicted transcriptional regulator, contains C-te 99.55
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.48
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.43
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.43
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.41
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.39
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.37
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.36
PF01645368 Glu_synthase: Conserved region in glutamate syntha 99.35
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.34
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.33
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.33
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide t 99.32
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.32
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.31
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.31
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.3
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.29
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.29
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.29
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.29
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.28
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.28
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.28
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.27
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.27
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.26
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.26
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.26
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.26
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.25
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.25
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.24
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.24
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.24
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.24
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.24
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.23
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.23
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.23
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 99.23
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.23
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.23
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.23
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.23
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.23
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.23
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.22
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.22
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.22
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.22
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 99.22
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.21
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.21
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.2
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.2
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.2
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.2
PLN02826409 dihydroorotate dehydrogenase 99.18
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 99.18
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.18
COG3620187 Predicted transcriptional regulator with C-termina 99.18
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.18
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.18
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.17
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.17
COG2905610 Predicted signal-transduction protein containing c 99.16
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide t 99.16
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.16
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.16
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.16
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.15
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.15
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.15
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.14
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.14
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.14
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.13
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.13
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.12
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.12
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.1
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.1
COG0517117 FOG: CBS domain [General function prediction only] 99.09
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 99.09
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.08
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 99.07
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.07
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.05
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.04
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.04
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.03
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.02
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.01
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.0
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.0
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.99
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 98.96
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.93
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.92
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.92
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 98.92
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.91
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.9
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 98.9
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 98.89
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 98.89
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.89
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.88
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 98.88
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 98.88
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 98.86
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.84
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 98.81
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.8
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.79
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 98.78
PRK11573413 hypothetical protein; Provisional 98.78
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 98.78
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 98.78
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 98.76
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 98.76
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.75
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.74
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 98.7
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.7
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.69
COG1253429 TlyC Hemolysins and related proteins containing CB 98.69
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.68
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.68
PRK14869546 putative manganese-dependent inorganic pyrophospha 98.68
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.65
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.63
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 98.6
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.59
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 98.58
PRK14024241 phosphoribosyl isomerase A; Provisional 98.56
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.56
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.54
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.51
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.49
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 98.47
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 98.47
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 98.46
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.46
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.38
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.36
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.36
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 98.36
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.35
PRK00208250 thiG thiazole synthase; Reviewed 98.34
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 98.34
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 98.34
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.32
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.31
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.31
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 98.3
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.3
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 98.28
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 98.28
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.27
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.26
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.24
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.24
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.22
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.2
COG2524294 Predicted transcriptional regulator, contains C-te 98.19
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.19
PRK07695201 transcriptional regulator TenI; Provisional 98.18
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.15
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 98.13
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 98.13
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 98.12
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 98.11
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.1
COG3448382 CBS-domain-containing membrane protein [Signal tra 98.09
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.08
PLN02334229 ribulose-phosphate 3-epimerase 98.05
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 98.05
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 98.04
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 98.03
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 98.03
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 98.03
PRK13523337 NADPH dehydrogenase NamA; Provisional 98.02
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 98.0
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.0
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 97.99
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.99
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 97.99
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.97
PRK04302223 triosephosphate isomerase; Provisional 97.94
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.93
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 97.93
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 97.92
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 97.91
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.9
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.9
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.9
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.89
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.89
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.87
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.87
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 97.86
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.82
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 97.8
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 97.79
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.77
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.75
COG3620187 Predicted transcriptional regulator with C-termina 97.75
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.74
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 97.74
PLN02460338 indole-3-glycerol-phosphate synthase 97.72
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 97.72
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.7
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 97.7
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 97.67
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 97.67
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 97.65
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 97.64
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 97.64
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.62
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.61
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.61
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 97.6
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.59
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 97.58
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 97.57
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.57
PLN02591250 tryptophan synthase 97.56
PRK10605362 N-ethylmaleimide reductase; Provisional 97.55
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.53
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.53
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.52
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.52
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 97.51
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 97.5
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.48
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.47
KOG1436398 consensus Dihydroorotate dehydrogenase [Nucleotide 97.47
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 97.47
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.44
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.42
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 97.42
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.41
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 97.39
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.39
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.39
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.38
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 97.38
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 97.34
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.32
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.31
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.28
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 97.27
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 97.27
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.25
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 97.24
PLN02411391 12-oxophytodienoate reductase 97.22
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.21
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.21
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 97.2
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 97.18
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 97.18
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.15
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.14
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 97.14
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.11
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 97.09
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 97.08
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 97.08
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 97.07
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.07
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 97.06
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 97.06
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.05
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 97.04
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 97.04
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.04
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 97.0
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 97.0
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.0
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 97.0
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 96.99
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.98
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 96.96
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 96.93
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 96.92
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 96.91
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 96.91
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 96.9
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 96.89
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 96.89
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 96.83
PRK01862574 putative voltage-gated ClC-type chloride channel C 96.83
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 96.83
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.82
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.79
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 96.79
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 96.78
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 96.78
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 96.77
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.75
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 96.75
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 96.75
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 96.74
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 96.73
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 96.73
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 96.73
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.72
PRK08091228 ribulose-phosphate 3-epimerase; Validated 96.72
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 96.71
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 96.7
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 96.7
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 96.68
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 96.68
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 96.66
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 96.66
PRK08227264 autoinducer 2 aldolase; Validated 96.65
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 96.64
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 96.63
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 96.63
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 96.63
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 96.63
COG2905 610 Predicted signal-transduction protein containing c 96.63
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 96.62
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 96.62
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 96.61
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 96.6
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 96.58
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.58
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 96.56
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 96.56
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 96.54
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 96.54
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 96.53
PRK14024241 phosphoribosyl isomerase A; Provisional 96.52
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 96.5
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 96.5
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 96.49
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.48
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 96.48
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 96.46
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 96.45
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 96.44
PRK08005210 epimerase; Validated 96.44
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.43
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 96.43
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 96.43
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 96.42
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 96.41
PRK14057254 epimerase; Provisional 96.41
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 96.39
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 96.38
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 96.38
cd02205113 CBS_pair The CBS domain, named after human CBS, is 96.38
COG0517117 FOG: CBS domain [General function prediction only] 96.34
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 96.33
PRK08999312 hypothetical protein; Provisional 96.33
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 96.33
PRK11573413 hypothetical protein; Provisional 96.29
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 96.29
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 96.29
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 96.25
COG1253429 TlyC Hemolysins and related proteins containing CB 96.24
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 96.23
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 96.23
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 96.22
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.22
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.22
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 96.21
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 96.2
PRK09016296 quinolinate phosphoribosyltransferase; Validated 96.2
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 96.19
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 96.16
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 96.16
PRK01362214 putative translaldolase; Provisional 96.16
TIGR01334277 modD putative molybdenum utilization protein ModD. 96.14
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 96.13
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 96.12
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 96.09
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 96.08
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 96.07
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 96.06
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 96.06
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 96.04
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 96.04
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.04
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 96.03
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 96.02
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 95.99
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 95.98
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 95.93
PRK05283257 deoxyribose-phosphate aldolase; Provisional 95.91
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 95.87
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 95.87
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.87
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 95.86
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.79
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 95.76
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 95.75
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 95.7
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.67
PRK06096284 molybdenum transport protein ModD; Provisional 95.67
PRK06852304 aldolase; Validated 95.66
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 95.65
cd02812219 PcrB_like PcrB_like proteins. One member of this f 95.65
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 95.64
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 95.61
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 95.6
COG4109432 Predicted transcriptional regulator containing CBS 95.59
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 95.59
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 95.56
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 95.53
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 95.51
smart0011649 CBS Domain in cystathionine beta-synthase and othe 95.47
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 95.47
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 95.44
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 95.44
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 95.42
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 95.4
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 95.39
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 95.39
PRK07315293 fructose-bisphosphate aldolase; Provisional 95.39
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 95.33
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 95.3
PRK06806281 fructose-bisphosphate aldolase; Provisional 95.29
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 95.28
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 95.27
KOG1799471 consensus Dihydropyrimidine dehydrogenase [Nucleot 95.23
PRK00208250 thiG thiazole synthase; Reviewed 95.22
PRK06801286 hypothetical protein; Provisional 95.17
PRK12653220 fructose-6-phosphate aldolase; Reviewed 95.12
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 95.0
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 95.0
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 94.89
COG4175386 ProV ABC-type proline/glycine betaine transport sy 94.89
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.86
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 94.86
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 94.71
PRK12655220 fructose-6-phosphate aldolase; Reviewed 94.7
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 94.57
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 94.52
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 94.48
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 94.37
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 94.33
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 94.31
PRK08185283 hypothetical protein; Provisional 94.27
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 94.26
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 94.19
PRK12376236 putative translaldolase; Provisional 94.15
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 94.08
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 94.07
PRK12656222 fructose-6-phosphate aldolase; Reviewed 94.02
PLN02591250 tryptophan synthase 93.87
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 93.87
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 93.84
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.83
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 93.82
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 93.77
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information 
Probab=100.00  E-value=1.3e-96  Score=777.31  Aligned_cols=497  Identities=75%  Similarity=1.106  Sum_probs=472.3

Q ss_pred             CCCCCccHHHhhccCCCCcccceeecCCCCCCCCCCeeeeeeecCcccccceEEEccchhhhHHHHHHHHHHcCCeeEEc
Q 010640            7 PIEDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVH   86 (505)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~d~~l~p~~~~~~~~~~~~~~~lt~~~~l~~Pli~a~m~~vt~~~ma~al~~~Gg~g~i~   86 (505)
                      ++.||++++++|+...+||||||+|+|+|+++.|+++++.+++|+++.+++|+++++|+++++.+|+++|++.||+|+|+
T Consensus         5 ~~~~~~~~~~~~~~~~~ltfddv~l~p~~~~~~~~~~~~~t~lt~~~~~~~Pivsa~M~~vt~~~lA~Ama~aGGiGfI~   84 (505)
T PLN02274          5 AFEDGFSAEKLFNQGVSYTYDDVIFHPGYIDFPADAVDLSTRLSRNIPLSIPCVSSPMDTVTESDMAIAMAALGGIGIVH   84 (505)
T ss_pred             cccCCcCHHHHhcCCCCCCccceEecccccCcCCcccccccccccccCcCCCEeccCCcccchHHHHHHHHhCCCeEEEc
Confidence            67899999999998899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHhhhccCCccccCCCeeEeCCCCCHHHHHHHhcC-Ce--EEEEeCCCCCCeEEEEEeccccccccccc
Q 010640           87 SNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGS-NY--VFVTESGTRRSRILGYVTKSDWENLSDNK  163 (505)
Q Consensus        87 ~~~~~~~~~~~v~~v~~~~~~~~~~p~~~~v~~~~tv~~a~~~~~~-~~--~pVvd~~~~~g~lvGivt~~Dl~~~~~~~  163 (505)
                      .+++++++..+++++++.+..|+.+|  +++++++|+.+++++|.+ ++  +||+|+++.+++++|+||.+|+++....+
T Consensus        85 ~~as~E~q~~~Irkvk~~~~gmi~dp--vtV~pd~tV~dA~~lm~~~~~~~lpVvD~~~~~GklvGIVT~~DL~~v~~~~  162 (505)
T PLN02274         85 YNNTAEEQAAIVRKAKSRRVGFVSDP--VVKSPSSTISSLDELKASRGFSSVCVTETGTMGSKLLGYVTKRDWDFVNDRE  162 (505)
T ss_pred             CCCCHHHHHHHHHHhhcccccccCCC--eeeCCCCcHHHHHHHHHhcCCceEEEEeCCCcCCeEEEEEEHHHHhhccccC
Confidence            99999999999999998888899999  999999999999999988 76  99998622237999999999998655567


Q ss_pred             cccccccccCCCceEecCCCCHHHHHHHHHHCCCCeeEEeeC-CeeeeEEeechhhhhhcCCCCCCCccCCCCcceEEEe
Q 010640          164 VKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKD-GERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAA  242 (505)
Q Consensus       164 ~~v~~im~~~~~~~~v~~~~~l~~a~~~l~~~~i~~lpVvd~-g~l~GiIt~~dil~~~~~~~~~~~~~d~~~~l~v~a~  242 (505)
                      .++.++|++..+++++++++++.+++++|.++++..+||+|+ ++++|+||++||++...++.+.++++|..++++++++
T Consensus       163 ~~V~eIMt~~~~lvtv~~~~sL~eAl~~m~~~~~~~LPVVD~~g~LvGvITr~DIlk~~~~p~~~~~~~d~~~~l~vgaa  242 (505)
T PLN02274        163 TKLSEVMTSDDDLVTAPAGIDLEEAEAVLKDSKKGKLPLVNEDGELVDLVTRTDVKRVKGYPKLGKPSVGKDGKLLVGAA  242 (505)
T ss_pred             CcHHHHhccCCCcEEECCCCCHHHHHHHHHHcCCCEEEEEcCCCeEEEEEEHHHHHHHhhCcCccccccCCCCCEEEEEE
Confidence            789999997334899999999999999999999999999998 9999999999999999999886667789999999999


Q ss_pred             ecCCccHHHHHHHHHHcCccEEEEeCCCCCchhHHHHHHHHHHhCCCceEEEcccCCHHHHHHHHHcCCCEEEEccCCcc
Q 010640          243 IGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGS  322 (505)
Q Consensus       243 i~~~~~~~e~~~~lieaGad~I~i~~~~g~~~~~~~~i~~l~~~~~~~~Vi~g~V~t~e~a~~l~~aGad~I~v~~g~g~  322 (505)
                      ++...+..++++.|+++|+|+|++|.++|++..+++.++++|+.+|+++||+|+|.|.++|+.++++|+|+|.+++|+|+
T Consensus       243 vg~~~~~~~r~~~l~~ag~d~i~iD~~~g~~~~~~~~i~~ik~~~p~~~vi~g~v~t~e~a~~a~~aGaD~i~vg~g~G~  322 (505)
T PLN02274        243 IGTRESDKERLEHLVKAGVDVVVLDSSQGDSIYQLEMIKYIKKTYPELDVIGGNVVTMYQAQNLIQAGVDGLRVGMGSGS  322 (505)
T ss_pred             EcCCccHHHHHHHHHHcCCCEEEEeCCCCCcHHHHHHHHHHHHhCCCCcEEEecCCCHHHHHHHHHcCcCEEEECCCCCc
Confidence            99888899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecccccccCcChHHHHHHHHHHHhhcCCcEEecCCCCCHHHHHHHHHhCCCEEEecccccCCCCCCccceeecCeEee
Q 010640          323 ICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVK  402 (505)
Q Consensus       323 ~~~~~~~~g~g~p~~~~l~~v~~~~~~~~ipvIa~GGI~~~~di~kal~lGA~~V~~G~~f~~~~Es~~~~~~~~~~~~k  402 (505)
                      +|+++...+.|.|+++++..+.++++..++|||++|||+++.|++|||++||++||+|++|+.|.|||++..+++|++||
T Consensus       323 ~~~t~~~~~~g~~~~~~i~~~~~~~~~~~vpVIadGGI~~~~di~kAla~GA~~V~vGs~~~~t~Esp~~~~~~~g~~~k  402 (505)
T PLN02274        323 ICTTQEVCAVGRGQATAVYKVASIAAQHGVPVIADGGISNSGHIVKALTLGASTVMMGSFLAGTTEAPGEYFYQDGVRVK  402 (505)
T ss_pred             cccCccccccCCCcccHHHHHHHHHHhcCCeEEEeCCCCCHHHHHHHHHcCCCEEEEchhhcccccCCcceeeeCCeEEE
Confidence            99999888889999999999999888889999999999999999999999999999999999999999999999999999


Q ss_pred             eecccCcHHHHhccccccccccccccccccceeeeeccCCchhhHHHHHHHHHHHHhhccCCCCHHHHHHhhhcCceeEE
Q 010640          403 KYRGMGSLEAMTKGSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLE  482 (505)
Q Consensus       403 ~~~g~~s~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~l~~~m~~~G~~~~~~l~~~~~~~~~~~~  482 (505)
                      .||||||++||.+++.+|||++..+..++||+++++||+|++.++|.+|.++||++|+|+|++||+|||+++|+|.++|+
T Consensus       403 ~yrgmgs~~a~~~~~~~ry~~~~~~~~v~egv~~~v~~~g~~~~~~~~~~~g~~~~~~y~g~~~~~~~~~~~~~~~~~f~  482 (505)
T PLN02274        403 KYRGMGSLEAMTKGSDQRYLGDTAKLKIAQGVSGAVADKGSVLKFVPYTMQAVKQGFQDLGASSLQSAHELLRSGTLRLE  482 (505)
T ss_pred             EEeccchHHHHhccccccccccCcccccCCceEEecccCCCHHHHHHHHHHHHHHhhhhcCcchHHHHHhhcccCceEEE
Confidence            99999999999989999999876667899999999999999999999999999999999999999999999999999999


Q ss_pred             EecccccccCccCcceeccccCC
Q 010640          483 VRTGAAQVEGGVHGLVSYEKKSF  505 (505)
Q Consensus       483 ~~~~~~~~e~~~~~~~~~~~~~~  505 (505)
                      ++|++|++||||||+++|+||+|
T Consensus       483 ~~t~~~~~e~~~h~~~~~~~~~~  505 (505)
T PLN02274        483 VRTGAAQVEGGVHGLVSYEKKAF  505 (505)
T ss_pred             EEchhhHhccCCCcceeccccCC
Confidence            99999999999999999999987

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK12376 putative translaldolase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query505
1b3o_A514 Ternary Complex Of Human Type-Ii Inosine Monophosph 1e-123
1jcn_A514 Binary Complex Of Human Type-I Inosine Monophosphat 1e-123
1jr1_A514 Crystal Structure Of Inosine Monophosphate Dehydrog 1e-122
4af0_B556 Crystal Structure Of Cryptococcal Inosine Monophosp 1e-114
4af0_A556 Crystal Structure Of Cryptococcal Inosine Monophosp 1e-114
1vrd_A494 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 6e-75
3tsb_A511 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 2e-68
3usb_A511 Crystal Structure Of Bacillus Anthracis Inosine Mon 2e-63
4fxs_A496 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 6e-63
1zfj_A491 Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1. 1e-59
3zfh_A510 Crystal Structure Of Pseudomonas Aeruginosa Inosine 2e-56
4avf_A490 Crystal Structure Of Pseudomonas Aeruginosa Inosine 3e-56
2cu0_A486 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 5e-53
4fez_A388 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 4e-50
4fo4_A366 Inosine 5'-Monophosphate Dehydrogenase From Vibrio 3e-49
3ffs_A400 The Crystal Structure Of Cryptosporidium Parvum Ino 2e-45
1eep_A404 2.4 A Resolution Crystal Structure Of Borrelia Burg 9e-45
3khj_A361 C. Parvum Inosine Monophosphate Dehydrogenase Bound 6e-42
1me8_A503 Inosine Monophosphate Dehydrogenase (Impdh) From Tr 2e-37
1me7_A503 Inosine Monophosphate Dehydrogenase (Impdh) From Tr 1e-36
2a7r_A366 Crystal Structure Of Human Guanosine Monophosphate 1e-28
2bzn_A351 Crystal Structure Of Human Guanosine Monophosphate 2e-28
2ble_A367 Structure Of Human Guanosine Monophosphate Reductas 3e-26
3r2g_A361 Crystal Structure Of Inosine 5' Monophosphate Dehyd 3e-24
1pvn_A376 The Crystal Structure Of The Complex Between Imp De 5e-24
1lrt_A376 Crystal Structure Of Ternary Complex Of Tritrichomo 7e-24
1ypf_A336 Crystal Structure Of Guac (Ba5705) From Bacillus An 2e-22
2a7n_A380 Crystal Structure Of The G81a Mutant Of The Active 9e-06
1huv_A380 Crystal Structure Of A Soluble Mutant Of The Membra 9e-06
2qr6_A393 Crystal Structure Of Imp DehydrogenaseGMP REDUCTASE 3e-04
>pdb|1B3O|A Chain A, Ternary Complex Of Human Type-Ii Inosine Monophosphate Dehydrogenase With 6-Cl-Imp And Selenazole Adenine Dinucleotide Length = 514 Back     alignment and structure 
Iteration: 1

 Score =  439 bits (1130), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 247/505 (48%), Positives = 316/505 (62%), Gaps = 13/505 (2%)
Query: 9   EDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVT 68
           +DG +A +LF+ G   TY+D + LP YIDF  D V L++ LT+ I L  P V+SPMDTVT
Sbjct: 15  DDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVT 74
Query: 69  EDYXXXXXXXLGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCIND--- 125
           E          GGIG +H NCT   QA  V   K       +    V  +P   + D   
Sbjct: 75  EAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDP--VVLSPKDRVRDVFE 132
Query: 126 ANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIF--DYMRDCSSNVSVPANY 183
           A    G   + +T++G   SR++G ++  D + L + +   F  + M      V  PA  
Sbjct: 133 AKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGI 192
Query: 184 DLGQIDEVLEKNDV-DFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAA 242
            L + +E+L+++      ++ +D E + ++ R D+++ + YP   K       + + GAA
Sbjct: 193 TLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA---KKQLLCGAA 249
Query: 243 IGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQ 302
           IGT E DK RL+ L +AGV+VVVLDSSQGNS FQI MIKY K  YP L VIGGNVVT  Q
Sbjct: 250 IGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQ 309
Query: 303 AQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISN 362
           A+NLI+AGVD LRVGMGSGSIC TQEV A GR QATAVYKVS  A + GVPVIADGGI N
Sbjct: 310 AKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQN 369
Query: 363 SGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTK--GSDQR 420
            GHI KAL LGASTVMMGS LA +TEAPG Y + +G R+KKYRGMGSL+AM K   S  R
Sbjct: 370 VGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNR 429
Query: 421 YLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLR 480
           Y  +  K+K+AQGV GAV DKGS+ KF+PY +  ++   QD+GA SL     ++ S  L+
Sbjct: 430 YFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELK 489
Query: 481 LEVRTGAAQVEGGVHGLVSYEKKSF 505
            E RT +AQVEGGVH L SYEK+ F
Sbjct: 490 FEKRTSSAQVEGGVHSLHSYEKRLF 514
>pdb|1JCN|A Chain A, Binary Complex Of Human Type-I Inosine Monophosphate Dehydrogenase With 6-Cl-Imp Length = 514 Back     alignment and structure
>pdb|1JR1|A Chain A, Crystal Structure Of Inosine Monophosphate Dehydrogenase In Complex With Mycophenolic Acid Length = 514 Back     alignment and structure
>pdb|4AF0|B Chain B, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|4AF0|A Chain A, Crystal Structure Of Cryptococcal Inosine Monophosphate Dehydrogenase Length = 556 Back     alignment and structure
>pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 Back     alignment and structure
>pdb|3TSB|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Bacillus Anthracis Str. Ames Length = 511 Back     alignment and structure
>pdb|3USB|A Chain A, Crystal Structure Of Bacillus Anthracis Inosine Monophosphate Dehydrogenase In The Complex With Imp Length = 511 Back     alignment and structure
>pdb|4FXS|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae Complexed With Imp And Mycophenolic Acid Length = 496 Back     alignment and structure
>pdb|1ZFJ|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1.1.205) From Streptococcus Pyogenes Length = 491 Back     alignment and structure
>pdb|3ZFH|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'-monophosphate Dehydrogenase Length = 510 Back     alignment and structure
>pdb|4AVF|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Inosine 5'- Monophosphate Dehydrogenase Length = 490 Back     alignment and structure
>pdb|2CU0|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 486 Back     alignment and structure
>pdb|4FEZ|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant Length = 388 Back     alignment and structure
>pdb|4FO4|A Chain A, Inosine 5'-Monophosphate Dehydrogenase From Vibrio Cholerae, Deletion Mutant, Complexed With Imp And Mycophenolic Acid Length = 366 Back     alignment and structure
>pdb|3FFS|A Chain A, The Crystal Structure Of Cryptosporidium Parvum Inosine-5'- Monophosphate Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1EEP|A Chain A, 2.4 A Resolution Crystal Structure Of Borrelia Burgdorferi Inosine 5'- Monphosphate Dehydrogenase In Complex With A Sulfate Ion Length = 404 Back     alignment and structure
>pdb|3KHJ|A Chain A, C. Parvum Inosine Monophosphate Dehydrogenase Bound By Inhibitor C64 Length = 361 Back     alignment and structure
>pdb|1ME8|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh) From Tritrichomonas Foetus With Rvp Bound Length = 503 Back     alignment and structure
>pdb|1ME7|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh) From Tritrichomonas Foetus With Rvp And Moa Bound Length = 503 Back     alignment and structure
>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 (Gmpr2) Length = 366 Back     alignment and structure
>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate Reductase 2 Gmpr2 In Complex With Imp Length = 351 Back     alignment and structure
>pdb|2BLE|A Chain A, Structure Of Human Guanosine Monophosphate Reductase Gmpr1 In Complex With Gmp Length = 367 Back     alignment and structure
>pdb|3R2G|A Chain A, Crystal Structure Of Inosine 5' Monophosphate Dehydrogenase From Legionella Pneumophila Length = 361 Back     alignment and structure
>pdb|1PVN|A Chain A, The Crystal Structure Of The Complex Between Imp Dehydrogenase Catalytic Domain And A Transition State Analogue Mzp Length = 376 Back     alignment and structure
>pdb|1LRT|A Chain A, Crystal Structure Of Ternary Complex Of Tritrichomonas Foetus Inosine-5'-Monophosphate Dehydrogenase: Structural Characterization Of Nad+ Site In Microbial Enzyme Length = 376 Back     alignment and structure
>pdb|1YPF|A Chain A, Crystal Structure Of Guac (Ba5705) From Bacillus Anthracis At 1.8 A Resolution Length = 336 Back     alignment and structure
>pdb|2A7N|A Chain A, Crystal Structure Of The G81a Mutant Of The Active Chimera Of (S)- Mandelate Dehydrogenase Length = 380 Back     alignment and structure
>pdb|1HUV|A Chain A, Crystal Structure Of A Soluble Mutant Of The Membrane-Associated (S)- Mandelate Dehydrogenase From Pseudomonas Putida At 2.15a Resolution Length = 380 Back     alignment and structure
>pdb|2QR6|A Chain A, Crystal Structure Of Imp DehydrogenaseGMP REDUCTASE-Like Protein (Np_599840.1) From Corynebacterium Glutamicum Atcc 13032 Kitasato At 1.50 A Resolution Length = 393 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query505
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 0.0
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 1e-122
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 1e-120
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 1e-120
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 1e-120
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 1e-119
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 1e-111
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 6e-84
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 2e-10
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 7e-84
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 3e-18
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 6e-80
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 2e-14
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 7e-78
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 5e-10
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 7e-76
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 3e-07
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 1e-75
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 6e-12
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 4e-66
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 3e-10
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 6e-49
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 1e-19
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 1e-18
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 2e-14
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 3e-14
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 1e-09
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 7e-09
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 8e-09
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 1e-08
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 1e-08
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 2e-08
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 3e-08
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 8e-08
1vr9_A213 CBS domain protein/ACT domain protein; structural 1e-06
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 2e-05
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 2e-05
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 3e-05
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 5e-05
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 7e-05
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 1e-04
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 2e-04
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 3e-04
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 3e-04
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 5e-04
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
 Score =  554 bits (1430), Expect = 0.0
 Identities = 246/511 (48%), Positives = 327/511 (63%), Gaps = 25/511 (4%)

Query: 9   EDGFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVT 68
           EDG +A +LF+     TY+D + LP +IDF  D V L++ LTR I L  P ++SPMDTVT
Sbjct: 15  EDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVT 74

Query: 69  EDYMAAAMAALGGIGIVHSNCTAADQARLVVSAKSRRVPIFSSS--LD-VFKAPDGCIND 125
           E  MA AMA +GGIG +H NCT   QA  V     R+V  F      D V  +P   + D
Sbjct: 75  EADMAIAMALMGGIGFIHHNCTPEFQANEV-----RKVKNFEQGFITDPVVLSPSHTVGD 129

Query: 126 AND------FDGSNYVFVTESGTRRSRILGYVTKSD--WENLSDNKVKIFDYMRDCSSNV 177
             +      F G   + +TE+GT  S+++G VT  D  +    D+   + + M      V
Sbjct: 130 VLEAKMRHGFSG---IPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV 186

Query: 178 SVPANYDLGQIDEVLEKNDVDFV-VLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGK 236
             PA   L + +E+L+++    + ++    E + ++ R D+++ + YP   K       +
Sbjct: 187 VAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKD---SQKQ 243

Query: 237 WMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGN 296
            + GAA+GTRE DK RL+ L +AGV+V+VLDSSQGNS +QI M+ Y K+ YP L VIGGN
Sbjct: 244 LLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGN 303

Query: 297 VVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIA 356
           VVT  QA+NLI+AGVDGLRVGMG GSIC TQEV A GR Q TAVYKV+  A + GVP+IA
Sbjct: 304 VVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIA 363

Query: 357 DGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEAMTK- 415
           DGGI   GH+VKAL LGASTVMMGS LA +TEAPG Y + +G R+KKYRGMGSL+AM K 
Sbjct: 364 DGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKS 423

Query: 416 -GSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLL 474
             S +RY  +  K+KIAQGV G++ DKGS+ KF+PY +  ++ G QD+GA SL     ++
Sbjct: 424 SSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMM 483

Query: 475 RSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF 505
            S  L+ E RT +AQ+EGGVHGL SYEK+ +
Sbjct: 484 YSGELKFEKRTMSAQIEGGVHGLHSYEKRLY 514
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Length = 351 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Length = 336 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Length = 234 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Length = 232 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Length = 328 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Length = 332 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Length = 326 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Length = 369 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Length = 365 Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Length = 368 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Length = 380 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Length = 224 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Length = 370 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Length = 368 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Length = 392 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Length = 352 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Length = 214 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Length = 225 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Length = 232 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query505
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 100.0
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 100.0
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 100.0
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 100.0
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 100.0
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 100.0
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 100.0
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 100.0
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 100.0
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 100.0
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 100.0
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 100.0
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 100.0
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 100.0
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 100.0
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 100.0
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.98
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.9
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.89
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.87
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 99.84
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.83
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.83
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.82
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.81
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.81
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.8
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.75
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.69
4esy_A170 CBS domain containing membrane protein; structural 99.68
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 99.67
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.66
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 99.66
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.65
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 99.65
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.65
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.63
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.6
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.59
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.59
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.59
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.59
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.59
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.56
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.55
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.55
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.55
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.55
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.55
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.54
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.54
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.54
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.53
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.52
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.52
3ocm_A173 Putative membrane protein; structural genomics, PS 99.52
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.51
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.51
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.51
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.5
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.5
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 99.5
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.5
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.5
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.49
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.49
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.48
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.47
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.47
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.45
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.45
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.45
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.44
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.43
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.43
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.42
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.42
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.41
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.4
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.4
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.38
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 99.38
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.38
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.36
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.36
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.35
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.35
3ddj_A296 CBS domain-containing protein; structural genomics 99.33
3ddj_A296 CBS domain-containing protein; structural genomics 99.33
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.33
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.31
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.28
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.27
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.23
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.23
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.22
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.19
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.19
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.18
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.16
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.15
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.14
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.14
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.11
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.1
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.1
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.03
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.02
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.0
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 98.91
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 98.89
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.88
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.87
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.85
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.83
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.81
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.8
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 98.78
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 98.77
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 98.74
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.7
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 98.67
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.66
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.63
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.62
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.62
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.6
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.55
4esy_A170 CBS domain containing membrane protein; structural 98.51
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.5
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 98.49
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.48
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.48
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 98.48
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.47
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 98.46
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 98.46
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.45
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.44
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.44
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 98.44
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.42
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 98.42
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.41
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 98.41
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 98.39
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.39
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 98.38
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 98.34
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 98.3
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.29
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.28
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.27
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 98.26
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.26
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 98.26
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.24
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.23
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 98.21
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.2
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.2
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.18
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.18
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 98.18
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 98.18
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.18
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.18
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.17
3fio_A70 A cystathionine beta-synthase domain protein fused 98.17
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.16
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 98.16
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.15
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.14
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 98.13
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.13
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.13
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.13
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.12
3fio_A70 A cystathionine beta-synthase domain protein fused 98.1
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.1
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 98.09
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 98.08
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 98.08
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.08
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 98.07
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 98.07
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.06
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.05
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.03
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.01
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 98.0
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.99
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 97.99
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 97.99
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 97.99
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 97.98
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 97.98
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.98
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 97.98
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 97.97
2o16_A160 Acetoin utilization protein ACUB, putative; struct 97.97
3oa3_A288 Aldolase; structural genomics, seattle structural 97.97
1pbj_A125 Hypothetical protein; structural genomics, domain, 97.97
3lqn_A150 CBS domain protein; csgid, structural genomics, un 97.96
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 97.96
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 97.96
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 97.95
3oco_A153 Hemolysin-like protein containing CBS domains; str 97.94
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.94
3ocm_A173 Putative membrane protein; structural genomics, PS 97.94
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 97.93
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 97.92
1pvm_A184 Conserved hypothetical protein TA0289; structural 97.87
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 97.86
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 97.85
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.85
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 97.85
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 97.85
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 97.84
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 97.84
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 97.81
1o50_A157 CBS domain-containing predicted protein TM0935; CB 97.8
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.8
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 97.78
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 97.77
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.76
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.75
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 97.74
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 97.74
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 97.74
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 97.73
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 97.73
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 97.72
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 97.71
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 97.7
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.7
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.69
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 97.69
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 97.68
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.67
3kxr_A205 Magnesium transporter, putative; cystathionine bet 97.65
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 97.64
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 97.63
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 97.62
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.6
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 97.6
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.58
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 97.56
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.54
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.54
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.51
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.48
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 97.47
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.44
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.42
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.4
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.39
2oux_A286 Magnesium transporter; 10001B, structural genomics 97.37
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 97.37
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 97.37
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 97.36
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.36
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.34
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.32
3kts_A192 Glycerol uptake operon antiterminator regulatory; 97.32
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 97.28
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 97.25
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.18
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.17
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.15
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 97.15
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 97.12
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 97.12
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 97.08
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 97.08
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.06
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.05
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.02
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 97.02
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 97.01
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.96
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 96.95
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 96.95
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 96.94
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.91
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.88
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 96.87
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 96.87
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 96.85
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.84
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 96.8
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 96.8
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 96.78
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 96.78
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 96.78
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 96.75
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 96.74
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 96.74
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 96.73
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 96.73
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 96.65
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 96.65
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 96.63
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 96.62
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 96.58
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 96.54
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.48
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.46
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.28
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 96.25
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 96.23
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 96.22
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 96.11
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 96.08
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.04
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 95.99
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 95.95
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 95.95
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 95.79
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 95.79
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 95.72
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 95.67
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 95.65
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 95.57
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 95.43
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 95.27
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 95.15
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.08
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.91
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 94.75
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 94.44
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 94.43
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 94.39
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.34
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 94.29
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 94.04
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 93.96
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 93.96
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 93.94
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 93.91
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 93.83
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 93.82
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 93.8
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 93.76
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 93.74
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 93.64
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 93.53
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 93.43
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 93.43
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 93.41
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 93.4
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 93.36
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 93.36
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 93.32
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.31
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 93.22
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 93.16
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 93.12
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 93.11
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 92.99
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 92.91
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 92.9
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 92.89
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 92.78
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 92.75
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 92.73
2oz8_A389 MLL7089 protein; structural genomics, unknown func 92.71
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 92.64
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 92.63
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 92.52
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 92.49
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 92.47
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 92.45
1wx0_A223 Transaldolase; structural genomics, riken structur 92.45
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 92.44
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 92.4
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 92.3
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 92.28
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 92.28
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 92.14
1vpx_A230 Protein (transaldolase (EC 2.2.1.2)); TM0295, stru 91.99
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 91.97
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 91.89
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 91.88
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 91.81
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 91.79
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 91.74
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 91.7
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 91.66
3kts_A192 Glycerol uptake operon antiterminator regulatory; 91.58
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 91.53
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 91.5
2qgy_A391 Enolase from the environmental genome shotgun sequ 91.47
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 91.46
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 91.41
1tzz_A392 Hypothetical protein L1841; structural genomics, m 91.26
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 91.09
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 91.01
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 91.01
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 91.0
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 90.99
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 90.9
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 90.7
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 90.69
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 90.59
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 90.54
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 90.48
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 90.47
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 90.41
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 90.37
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 90.37
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 90.34
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 90.34
1l6w_A220 Fructose-6-phosphate aldolase 1; alpha-beta barrel 90.31
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 90.27
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 90.12
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 90.1
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 90.07
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 90.02
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 90.0
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 89.99
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 89.96
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 89.94
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 89.91
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 89.89
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 89.88
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 89.86
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 89.86
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 89.85
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 89.84
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 89.76
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 89.75
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 89.62
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 89.59
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 89.55
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 89.52
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 89.45
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 89.3
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 89.2
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 89.2
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 89.19
3eez_A378 Putative mandelate racemase/muconate lactonizing e 89.11
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 89.07
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 89.06
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 89.05
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 89.04
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 89.03
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 89.01
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 89.01
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 88.98
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 88.96
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 88.95
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 88.92
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 88.91
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 88.88
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.73
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 88.73
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 88.72
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 88.67
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 88.65
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 88.59
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 88.57
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 88.57
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 88.51
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 88.49
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 88.48
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 88.46
3oa3_A288 Aldolase; structural genomics, seattle structural 88.43
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.39
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 88.38
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 88.36
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.22
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 88.21
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 88.19
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase 88.11
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 88.06
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 88.05
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 88.01
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 87.94
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.92
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 87.9
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 87.75
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 87.71
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 87.55
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 87.54
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 87.43
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 87.43
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 87.35
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 87.05
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 87.04
3tha_A252 Tryptophan synthase alpha chain; structural genomi 86.92
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 86.87
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 86.87
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 86.83
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 86.82
1ujp_A271 Tryptophan synthase alpha chain; riken structural 86.81
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 86.8
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 86.78
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 86.77
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 86.76
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
Probab=100.00  E-value=1.2e-107  Score=843.77  Aligned_cols=494  Identities=47%  Similarity=0.747  Sum_probs=353.0

Q ss_pred             CCCCCCCCccHHHhhccC--CCCcccceeecCCCCCCCCCCeeeeeeecCcccccceEEEccchhhhHHHHHHHHHHcCC
Q 010640            4 SPLPIEDGFSADRLFSQG--YSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGG   81 (505)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~--~~~~~~d~~l~p~~~~~~~~~~~~~~~lt~~~~l~~Pli~a~m~~vt~~~ma~al~~~Gg   81 (505)
                      +-|++.||+++.++|...  .+||||||+|+|+|++++|+++++.|++|+++.+++|+|+|+||+||+.+||++|++.||
T Consensus        38 ~~~~~~dg~~~~~l~~~~~~~GLTfDDVlLvP~~s~v~p~~Vdl~t~lt~~i~L~iPlvSA~MDTVTe~~MAIamAr~GG  117 (556)
T 4af0_A           38 EEYPRGDGLSLQELMDSRKNGGLTYNDFLVLPGHINFPASDVSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGG  117 (556)
T ss_dssp             TTSSSCSSBCHHHHTCHHHHCSCCGGGEEECCCCCCSCGGGCCCCEEEETTEEESSCEEECCCTTTCSHHHHHHHHHTTC
T ss_pred             HhCCCcCCCCHHHHhcCCCCCCCChhhEEEccCCCCCCcccceeeeeccCCcEeCCCEEecCcccccCHHHHHHHHHCCC
Confidence            359999999999999753  389999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEcCCCCHHHHHHHHHhhhccCCccccCCCeeEeCCCCCHHHHHHHhcC-Ce--EEEEeCCCCCCeEEEEEecccccc
Q 010640           82 IGIVHSNCTAADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGS-NY--VFVTESGTRRSRILGYVTKSDWEN  158 (505)
Q Consensus        82 ~g~i~~~~~~~~~~~~v~~v~~~~~~~~~~p~~~~v~~~~tv~~a~~~~~~-~~--~pVvd~~~~~g~lvGivt~~Dl~~  158 (505)
                      +|+||+|+++++|+++++++|+++++|..+|  ++++|+.|+.|+.++|.+ ++  +||++++..+++|+||||.+|+++
T Consensus       118 iGvIH~n~sie~Qa~~V~~VKr~e~g~i~dP--vtl~P~~Tv~da~~l~~~~~isgvpVvd~g~~~~kLvGIvT~RD~rf  195 (556)
T 4af0_A          118 LGIIHHNCSAEEQAAMVRRVKKYENGFITDP--LCLGPDATVGDVLEIKAKFGFCGVPITETGEPDSKLLGIVTGRDVQF  195 (556)
T ss_dssp             EEEECCSSCHHHHHHHHHHHHHCCC-------------------------------------------------------
T ss_pred             eEEEcCCCCHHHHHHHHHHHHhcccCccCCC--eEcCCCCCHHHHHHHHHHhCCCccccccccCcCCEEEEEEecccccc
Confidence            9999999999999999999999999999999  999999999999999999 88  999997666789999999999998


Q ss_pred             ccccccccccccccCCCceEecCCCCHHHHHHHHHHCCCCeeEEeeC-CeeeeEEeechhhhhhcCCCCCCCcc-CCCCc
Q 010640          159 LSDNKVKIFDYMRDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKD-GERLDVVTREDVERLKGYPNLGKGTV-GPDGK  236 (505)
Q Consensus       159 ~~~~~~~v~~im~~~~~~~~v~~~~~l~~a~~~l~~~~i~~lpVvd~-g~l~GiIt~~dil~~~~~~~~~~~~~-d~~~~  236 (505)
                      . +.++++.++|++  ++++++++.++++|.++|.++++..|||||+ ++|+|+||++|+++...++++   .+ |..++
T Consensus       196 ~-d~~~~V~evMT~--~lvt~~~~~~leeA~~iL~~~kieklpVVd~~g~LvGlIT~kDi~k~~~~p~A---~k~d~~gr  269 (556)
T 4af0_A          196 Q-DAETPIKSVMTT--EVVTGSSPITLEKANSLLRETKKGKLPIVDSNGHLVSLVARSDLLKNQNYPYA---SKVPESKQ  269 (556)
T ss_dssp             -----------------------------------------------------------------CTTC---CBCTTTCC
T ss_pred             c-ccceEhhhhccc--ceEEecCCCCHHHHHHHHHHccccceeEEccCCcEEEEEEechhhhhhhCCcc---hhcchhhc
Confidence            5 567899999998  8999999999999999999999999999999 999999999999999999987   65 78899


Q ss_pred             ceEEEeecCCccHHHHHHHHHHcCccEEEEeCCCCCchhHHHHHHHHHHhCCCceEEEcccCCHHHHHHHHHcCCCEEEE
Q 010640          237 WMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRV  316 (505)
Q Consensus       237 l~v~a~i~~~~~~~e~~~~lieaGad~I~i~~~~g~~~~~~~~i~~l~~~~~~~~Vi~g~V~t~e~a~~l~~aGad~I~v  316 (505)
                      ++++++++..++..++++.|+++|+|++++|.++|++..+++.++++++.+|+++|++|||.|.+.++.|+++|+|++.|
T Consensus       270 L~VgAAVgv~~d~~eR~~aLv~AGvD~iviD~ahGhs~~v~~~i~~ik~~~p~~~viaGNVaT~e~a~~Li~aGAD~vkV  349 (556)
T 4af0_A          270 LYCGAAIGTRPGDKDRLKLLAEAGLDVVVLDSSQGNSVYQIEFIKWIKQTYPKIDVIAGNVVTREQAAQLIAAGADGLRI  349 (556)
T ss_dssp             BCCEEEECSSHHHHHHHHHHHHTTCCEEEECCSCCCSHHHHHHHHHHHHHCTTSEEEEEEECSHHHHHHHHHHTCSEEEE
T ss_pred             eeeEEEeccCccHHHHHHHHHhcCCcEEEEeccccccHHHHHHHHHHHhhCCcceEEeccccCHHHHHHHHHcCCCEEee
Confidence            99999999998899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcceeecccccccCcChHHHHHHHHHHHhhcCCcEEecCCCCCHHHHHHHHHhCCCEEEecccccCCCCCCccceee
Q 010640          317 GMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQ  396 (505)
Q Consensus       317 ~~g~g~~~~~~~~~g~g~p~~~~l~~v~~~~~~~~ipvIa~GGI~~~~di~kal~lGA~~V~~G~~f~~~~Es~~~~~~~  396 (505)
                      ++|+|++|+||...|.|.|+++++.+|+++++++++|||+||||+++.||+|||++|||+||+|++|+.|.|||++.+++
T Consensus       350 GiGpGSiCtTr~v~GvG~PQ~tAi~~~a~~a~~~~vpvIADGGI~~sGDi~KAlaaGAd~VMlGsllAGt~EsPGe~~~~  429 (556)
T 4af0_A          350 GMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYH  429 (556)
T ss_dssp             CSSCSTTBCCTTTCCSCCCHHHHHHHHHHHHGGGTCCEEEESCCCSHHHHHHHHHTTCSEEEESTTTTTBTTSSSCCEEE
T ss_pred             cCCCCcccccccccCCCCcHHHHHHHHHHHHHHcCCCEEecCCcCcchHHHHHhhcCCCEEEEchhhccccCCCCcEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCeEeeeecccCcHHHHhc-----------------cccccccccccccccccceeeeeccCCchhhHHHHHHHHHHHHh
Q 010640          397 NGRRVKKYRGMGSLEAMTK-----------------GSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGF  459 (505)
Q Consensus       397 ~~~~~k~~~g~~s~~~~~~-----------------~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~l~~~m  459 (505)
                      +|++||.||||||++||++                 ++.+|||++..+.+++||+++++||+|++.+++.+|.++||++|
T Consensus       430 ~G~~~K~YrGMgS~~Am~~~~~~~~~~~~~~~~~~~~s~dRyfq~~~~~~v~EGveg~VpykG~v~~~i~~l~gGlrs~m  509 (556)
T 4af0_A          430 EGKRVKVYRGMGSIEAMEHTQRGSASGKRSILGLDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSL  509 (556)
T ss_dssp             TTEEEEEEECTTSHHHHTTC------------CCSCSSEEECCCBSSSSCBCCBCEEEEECCBCHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEeecccccHHHHHhcccCCcccccccccccccchhhhcccccccccCCccEEeccCCCcHHHHHHHHHHHHHHhh
Confidence            9999999999999999963                 35679999888888999999999999999999999999999999


Q ss_pred             hccCCCCHHHHHHhhhcCceeEEEecccccccCccCcceeccccCC
Q 010640          460 QDLGASSLQSAHDLLRSRTLRLEVRTGAAQVEGGVHGLVSYEKKSF  505 (505)
Q Consensus       460 ~~~G~~~~~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~  505 (505)
                      +|+|++||+|||+++++|..||+++|++++.||||||+++|+||-|
T Consensus       510 ~y~Ga~~i~el~~~a~~g~~rf~~iT~ag~~Es~~Hdv~s~~K~l~  555 (556)
T 4af0_A          510 QDAAIKSVSELHSCARSGSLRFELRTASAQLEGGVHGLNSYTKRLF  555 (556)
T ss_dssp             HHTTCSSHHHHHHHHHHTCSCEEECCCC------------------
T ss_pred             hccCCCcHHHHHHhhhccCceEEEEChhhhhhcCCCccceeeeecc
Confidence            9999999999999999999999999999999999999999999976
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1wx0_A Transaldolase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferas; 2.27A {Thermus thermophilus HB8} SCOP: c.1.10.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1l6w_A Fructose-6-phosphate aldolase 1; alpha-beta barrel, domain swapping, lyase; 1.93A {Escherichia coli} SCOP: c.1.10.1 Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 505
d1zfja1365 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate d 1e-63
d1zfja1365 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate d 9e-20
d1jr1a1378 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate 1e-62
d1jr1a1378 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate 2e-27
d1vrda1330 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate d 2e-56
d1vrda1330 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate d 1e-17
d1eepa_388 c.1.5.1 (A:) Inosine monophosphate dehydrogenase ( 5e-47
d2cu0a1368 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate d 1e-44
d2cu0a1368 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate d 1e-20
d1pvna1362 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate d 3e-41
d1pvna1362 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate d 2e-17
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 3e-17
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 6e-16
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 2e-10
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 1e-04
d1vcfa1310 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i 6e-09
d1kbia1414 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal 7e-07
d1p4ca_353 c.1.4.1 (A:) Membrane-associated (S)-mandelate deh 7e-07
d1pkla2258 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-ter 2e-04
d1tb3a1349 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus 3e-04
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 4e-04
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 0.001
d1a3xa2265 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-ter 0.001
d2g50a2282 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-t 0.002
d1ofda2809 c.1.4.1 (A:431-1239) Alpha subunit of glutamate sy 0.003
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 365 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Inosine monophosphate dehydrogenase (IMPDH)
family: Inosine monophosphate dehydrogenase (IMPDH)
domain: Inosine monophosphate dehydrogenase (IMPDH)
species: Streptococcus pyogenes [TaxId: 1314]

 Score =  209 bits (533), Expect = 1e-63
 Identities = 101/269 (37%), Positives = 151/269 (56%), Gaps = 8/269 (2%)

Query: 233 PDGKWMVGAAIGTRESDKERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDV 292
            +G+ +V AA+G      ER E L +AG + +V+D++ G+S+  +  I   +  +P   +
Sbjct: 92  SEGRLLVAAAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHFPNRTL 151

Query: 293 IGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAAQSGV 352
           I GN+ T   A+ L +AGVD ++VG+G GSICTT+ V  VG  Q TA+Y  +++A + G 
Sbjct: 152 IAGNIATAEGARALYDAGVDVVKVGIGPGSICTTRVVAGVGVPQVTAIYDAAAVAREYGK 211

Query: 353 PVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSLEA 412
            +IADGGI  SG IVKAL  G + VM+GS  AG+ EAPG      GR+ K YRGMGS+ A
Sbjct: 212 TIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIYQGRKYKTYRGMGSIAA 271

Query: 413 MTKGSDQRYLG---DKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQS 469
           M KGS  RY     ++A   + +G+ G VA KG+    +   +  ++ G   +GA  +Q 
Sbjct: 272 MKKGSSDRYFQGSVNEANKLVPEGIEGRVAYKGAASDIVFQMLGGIRSGMGYVGAGDIQE 331

Query: 470 AHDLLRSRTLRLEVRTGAAQVEGGVHGLV 498
               L     +    +GA  +E   H + 
Sbjct: 332 ----LHENA-QFVEMSGAGLIESHPHDVQ 355
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 365 Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 378 Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 378 Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Length = 330 Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Length = 330 Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Length = 388 Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Length = 368 Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Length = 368 Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Length = 362 Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Length = 362 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414 Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 353 Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Length = 258 Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 349 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 265 Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 282 Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Length = 809 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query505
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 100.0
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 99.93
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 99.88
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 99.88
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 99.82
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 99.82
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 99.82
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.74
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.71
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.68
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.67
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.66
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.66
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.65
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.65
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.64
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.64
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.63
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.62
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.62
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.62
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.56
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.56
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.54
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.54
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.53
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.52
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.47
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.47
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.46
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.36
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.35
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.29
d1ofda2809 Alpha subunit of glutamate synthase, central and F 99.26
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.22
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 99.2
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.19
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.18
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.15
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.08
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 99.04
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 98.89
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 98.88
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 98.88
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 98.84
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 98.62
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.51
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.51
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.44
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 98.39
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.36
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.34
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.33
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.31
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.31
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 98.31
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 98.3
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.28
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 98.27
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 98.24
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.23
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 98.2
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 98.2
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 98.16
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.15
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.12
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 98.1
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.08
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 98.05
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.04
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 98.02
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 98.01
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 98.01
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 97.98
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 97.92
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 97.91
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 97.85
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.84
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 97.83
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.8
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 97.79
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 97.76
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.75
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 97.75
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 97.74
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 97.71
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 97.7
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 97.68
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 97.67
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 97.64
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 97.61
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 97.57
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.53
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 97.52
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 97.49
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 97.46
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.44
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 97.38
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 97.23
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 97.21
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 97.19
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.17
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.16
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 97.05
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.04
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 96.99
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 96.98
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 96.96
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 96.91
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 96.91
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 96.82
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 96.29
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 96.19
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 96.12
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 96.1
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 96.08
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 95.96
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 95.93
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 95.84
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 95.73
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 95.68
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 95.39
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 95.18
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 95.16
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 95.09
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 94.96
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 94.95
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 94.94
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 94.67
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 94.65
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 94.56
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 94.55
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 94.51
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 94.49
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.41
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 94.37
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 94.27
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 94.2
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 94.15
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 94.09
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 93.94
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 93.94
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 93.89
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 93.83
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 93.71
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 93.51
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 93.33
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 93.29
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 93.23
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 92.89
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 92.87
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 92.83
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 92.63
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 92.49
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 91.44
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 90.99
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 90.91
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 90.89
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 90.75
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 90.39
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 90.24
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 89.65
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 89.29
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 88.82
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 88.15
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 88.11
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 87.97
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 87.68
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 87.4
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 86.94
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 86.64
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 85.75
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 85.65
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 85.35
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 85.34
d1ofda2809 Alpha subunit of glutamate synthase, central and F 85.29
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 85.29
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 85.1
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 85.07
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 84.98
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 84.88
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 84.37
d2basa1261 Hypothetical protein YkuI, N-terminal domain {Baci 84.34
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 84.26
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 84.07
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 83.96
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 83.86
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 83.55
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 83.54
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 83.35
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 83.17
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 83.01
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 82.19
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 82.08
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 82.06
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 81.3
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 81.25
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 80.88
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 80.63
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 80.62
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Inosine monophosphate dehydrogenase (IMPDH)
family: Inosine monophosphate dehydrogenase (IMPDH)
domain: Inosine monophosphate dehydrogenase (IMPDH)
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=100.00  E-value=3e-73  Score=577.74  Aligned_cols=376  Identities=59%  Similarity=0.892  Sum_probs=340.3

Q ss_pred             CccHHHhhccCCCCcccceeecCCCCCCCCCCeeeeeeecCcccccceEEEccchhhhHHHHHHHHHHcCCeeEEcCCCC
Q 010640           11 GFSADRLFSQGYSYTYDDVIFLPHYIDFPIDAVSLSTRLTRNIDLSLPCVASPMDTVTEDYMAAAMAALGGIGIVHSNCT   90 (505)
Q Consensus        11 ~~~~~~~~~~~~~~~~~d~~l~p~~~~~~~~~~~~~~~lt~~~~l~~Pli~a~m~~vt~~~ma~al~~~Gg~g~i~~~~~   90 (505)
                      ||+++++|+.+.+||||||+|+|+++++.++++++.|++|+.+.+.+|+|+||||++++.+|+++|++.||+|+||++++
T Consensus         1 ~~~~~~~~~~~~~LtfdDVllvP~~st~~sr~V~l~t~lt~~~~l~iPIIsApMdtVt~~~mA~als~~GGLGvLhr~~~   80 (378)
T d1jr1a1           1 GLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCT   80 (378)
T ss_dssp             CBCHHHHTSSCCCCCGGGEEECCCCCCSCGGGCBCCEESSSSCEESSCEEECCCTTTCSHHHHHHHHHHTCEEEECCSSC
T ss_pred             CCCHHHhhccCCCCCcccEEEeCCCCCCcHHHceeeeEEECCccCCCCEEECCCCCcCCHHHHHHHHHCCCeeEEcCCCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhccCCccccCCCeeEeCCCCCHHHHHHHhcCCeEEEEeCCCCCCeEEEEEecccccccccccccccccc
Q 010640           91 AADQARLVVSAKSRRVPIFSSSLDVFKAPDGCINDANDFDGSNYVFVTESGTRRSRILGYVTKSDWENLSDNKVKIFDYM  170 (505)
Q Consensus        91 ~~~~~~~v~~v~~~~~~~~~~p~~~~v~~~~tv~~a~~~~~~~~~pVvd~~~~~g~lvGivt~~Dl~~~~~~~~~v~~im  170 (505)
                      ++++.+++++++...+    .|  .                                                      .
T Consensus        81 ~e~~~~ev~~v~~~~~----~p--~------------------------------------------------------~  100 (378)
T d1jr1a1          81 PEFQANEVRKVKKYEQ----YP--L------------------------------------------------------A  100 (378)
T ss_dssp             HHHHHHHHHHHHTSCC----CT--T------------------------------------------------------C
T ss_pred             HHHHHHHHheehhhhh----Cc--c------------------------------------------------------c
Confidence            9999999988776542    22  0                                                      0


Q ss_pred             ccCCCceEecCCCCHHHHHHHHHHCCCCeeEEeeCCeeeeEEeechhhhhhcCCCCCCCccCCCCcceEEEeecCCccHH
Q 010640          171 RDCSSNVSVPANYDLGQIDEVLEKNDVDFVVLEKDGERLDVVTREDVERLKGYPNLGKGTVGPDGKWMVGAAIGTRESDK  250 (505)
Q Consensus       171 ~~~~~~~~v~~~~~l~~a~~~l~~~~i~~lpVvd~g~l~GiIt~~dil~~~~~~~~~~~~~d~~~~l~v~a~i~~~~~~~  250 (505)
                                                                                 ..+...++.+++.++..++..
T Consensus       101 -----------------------------------------------------------~~~~~~~l~v~aavg~~~~~~  121 (378)
T d1jr1a1         101 -----------------------------------------------------------SKDAKKQLLCGAAIGTHEDDK  121 (378)
T ss_dssp             -----------------------------------------------------------CBCTTSCBCCEEEECSSTHHH
T ss_pred             -----------------------------------------------------------ccccccCEEEEEEeccCHHHH
Confidence                                                                       111223456677887777888


Q ss_pred             HHHHHHHHcCccEEEEeCCCCCchhHHHHHHHHHHhCCCceEEEcccCCHHHHHHHHHcCCCEEEEccCCcceeeccccc
Q 010640          251 ERLEHLVKAGVNVVVLDSSQGNSSFQIEMIKYAKKTYPELDVIGGNVVTMYQAQNLIEAGVDGLRVGMGSGSICTTQEVC  330 (505)
Q Consensus       251 e~~~~lieaGad~I~i~~~~g~~~~~~~~i~~l~~~~~~~~Vi~g~V~t~e~a~~l~~aGad~I~v~~g~g~~~~~~~~~  330 (505)
                      ++++.+.++|+++++++.++|++..+.+.++++++.+|++++++|+|.|.+.++.|.++|||+|.|++|+|+.|+++...
T Consensus       122 ~~~~~l~~agv~vi~id~a~g~~~~~~~~i~~ik~~~~~~~iIaGnVaT~e~a~~L~~aGAD~VkVGiG~Gs~ctTr~~t  201 (378)
T d1jr1a1         122 YRLDLLALAGVDVVVLDSSQGNSIFQINMIKYMKEKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGCGSICITQEVL  201 (378)
T ss_dssp             HHHHHHHHHTCCEEEECCSSCCSHHHHHHHHHHHHHSTTCEEEEEEECSHHHHHHHHHHTCSEEEECSSCSTTBCHHHHH
T ss_pred             HHHHHHHhhccceEeeeccCccchhhHHHHHHHHHHCCCCceeecccccHHHHHHHHHhCCCEEeecccccccccccccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcChHHHHHHHHHHHhhcCCcEEecCCCCCHHHHHHHHHhCCCEEEecccccCCCCCCccceeecCeEeeeecccCcH
Q 010640          331 AVGRGQATAVYKVSSIAAQSGVPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYVYQNGRRVKKYRGMGSL  410 (505)
Q Consensus       331 g~g~p~~~~l~~v~~~~~~~~ipvIa~GGI~~~~di~kal~lGA~~V~~G~~f~~~~Es~~~~~~~~~~~~k~~~g~~s~  410 (505)
                      |.|.|+++++.+|+++++.+++||||||||+++.|++|||++|||+||||++|+.|.|||++.++++|++||.||||+|.
T Consensus       202 GvG~pq~sai~~~~~~a~~~~vpIIADGGi~~~gdiakAla~GAd~VMmGs~fAgt~EspG~~~~~~g~~~k~~~gm~S~  281 (378)
T d1jr1a1         202 ACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSL  281 (378)
T ss_dssp             CCCCCHHHHHHHHHHHHGGGTCCEEEESCCCSHHHHHHHHHTTCSEEEESTTTTTBTTSSSCCEESSSCEEEEEECTTST
T ss_pred             ccCcccchhhhHHHHhhcccCCceecccccccCCceeeEEEeecceeeecceeeeeecccCccceecCceeeeccccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhc--cccccccccccccccccceeeeeccCCchhhHHHHHHHHHHHHhhccCCCCHHHHHHhhhcCceeEEEecccc
Q 010640          411 EAMTK--GSDQRYLGDKAKLKIAQGVVGAVADKGSVLKFIPYTMQAVKQGFQDLGASSLQSAHDLLRSRTLRLEVRTGAA  488 (505)
Q Consensus       411 ~~~~~--~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~l~~~m~~~G~~~~~~l~~~~~~~~~~~~~~~~~~  488 (505)
                      .||.+  ++..|||++..+.+++||+++.+||+|++.+++.+|.++||++|+|+|++||+|||+..+++.++|+++|.++
T Consensus       282 ~a~~~~~~~~~~~~~~~~~~~~~eG~~~~v~~~G~v~~~~~~l~gglrs~m~y~G~~~l~e~~~~~~~~~~~f~~~t~~~  361 (378)
T d1jr1a1         282 DAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSA  361 (378)
T ss_dssp             TTC----------------CCCCCBCEEEEECCBCHHHHHHHHHHHHHHHHHHTTCSBHHHHHHHHHHSCSCEEECCHHH
T ss_pred             hhhhcccchhhhhccccccccCCCccEEeeccCCCHHHHHHHHHHHHHHhhhccCcCcHHHHHhhhccCCceEEEEChhh
Confidence            99976  6778999988888899999999999999999999999999999999999999999999889999999999999


Q ss_pred             cccCccCcceeccccCC
Q 010640          489 QVEGGVHGLVSYEKKSF  505 (505)
Q Consensus       489 ~~e~~~~~~~~~~~~~~  505 (505)
                      ++||+|||+++++++-|
T Consensus       362 ~~e~~~h~~~~~~~~~~  378 (378)
T d1jr1a1         362 QVEGGVHSLHSYEKRLF  378 (378)
T ss_dssp             HHHHSCCSCSCCCCCCC
T ss_pred             hhccCCCcccccccccC
Confidence            99999999999999876
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure