Citrus Sinensis ID: 010669


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
cEEEcccccccccEECccccCEEHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccECccCCccEEcccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEEcccccEEEEEEECcccEEEEECccccEEEEEcccccccEEEEEcccccccEEEEEEcccccEEEEEEcccEEEEEEccccCEEEEEcccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEcccEEEEEccccccccEEEEECccccccCEEEEEEEEccccccc
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSL**QS*************************************HTGITPAIIAELTDCNAA**************APIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVxxxxxxxxxxxxxxxxxxxxxIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA-processing factor 19 homolog 2 Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immnunity. Functions as U-box E3 ubiquitin-protein ligase. May also serve as a support for spliceosome binding and activity.confidentO22785
U-box domain-containing protein 72 Possesses E3 ubiquitin-protein ligase in vitro.confidentQ9AV81
Pre-mRNA-processing factor 19 homolog 1 Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Functions as U-box E3 ubiquitin-protein ligase (By similarity). May also serve as a support for spliceosome binding and activity.probableQ94BR4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 218-471
View the alignment between query and template
View the model in PyMOL
Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 219-501
View the alignment between query and template
View the model in PyMOL
Template: 2BAY, chain A
Confidence level:confident
Coverage over the Query: 1-56
View the alignment between query and template
View the model in PyMOL
Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 74-137
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3mks, chain Bprobable Alignment | Template Structure