Citrus Sinensis ID: 010669


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
cEEEcccccccccEEEccccEEEHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEccEEccEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEcccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEcccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEcccEEEEEccccccccEEEEEEccccccEEEEEEEEEccccccc
cEEEEccccccccEEccccccHHHHHHHHHHHHHccccccccccccHHHHEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEccccccccEcccccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEcccccccEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEccccEEEEEccccccccEEEEEcccccccccEEEEEEEccccccc
mncsisgevpeepvvsknsgllfEKRLIERHIldygkcpvtgepltmddivpiktgkivkprpltaasipgmlgmfqnEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSErqimpaestavtsnaalsngkrapededlgpagkklhtgitPAIIAELTDCNAALSQQRkkrqvppalapiDALERYTqlashplhktskpgivsldihyskdviatggvdtnavlfdrpsgqivttlsghskkvtsvkfvtegdlfltgsadkTVRVwqgsedgnydckhtlKDHTAEVQAVTVHATNKYFVTASLdntwcfydlssgicltqvsdagtdgrpegytsaafhpdglilgtgTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDgvklwdlrklknfrsfessdsetptnsvdfdhsgsyLAVASADIRVYQVASVKAdwnciktfpdlsgtgaASFLFLFVLGQTCS
mncsisgevpeepvvsknsgLLFEKRLIERHILdygkcpvtgepltmddivpiktgkivkprpLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAqserqimpaestavtsnaalsngkrapededlgPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLashplhktskpgiVSLDIHYSKDVIATGGVDTNAVLFDRPSGQivttlsghskkvtsvkfvtegdlfltgsadktvrVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRsfessdsetptnsvdfdHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
*******************GLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARL***************************************************HTGITPAIIAELTDCNAA***************PIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNF******************HSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQ***
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTG****PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSL**QS********************************************IIAELT*******************APIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTC*
****************KNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAA***********PALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRS************VDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSER********************RAP**EDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVxxxxxxxxxxxxxxxxxxxxxIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQTCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query504 2.2.26 [Sep-21-2011]
O22785525 Pre-mRNA-processing facto yes no 0.960 0.921 0.768 0.0
Q9AV81527 U-box domain-containing p yes no 0.966 0.924 0.752 0.0
Q94BR4523 Pre-mRNA-processing facto no no 0.962 0.927 0.752 0.0
Q9UMS4504 Pre-mRNA-processing facto yes no 0.934 0.934 0.465 1e-112
Q08E38504 Pre-mRNA-processing facto yes no 0.934 0.934 0.463 1e-111
Q9JMJ4504 Pre-mRNA-processing facto yes no 0.934 0.934 0.461 1e-111
Q99KP6504 Pre-mRNA-processing facto yes no 0.934 0.934 0.461 1e-111
Q5ZMA2505 Pre-mRNA-processing facto yes no 0.934 0.932 0.450 1e-107
Q10051492 Pre-mRNA-processing facto yes no 0.902 0.924 0.408 2e-96
Q7KWK5514 Pre-mRNA-processing facto yes no 0.902 0.885 0.384 8e-81
>sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 Back     alignment and function desciption
 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/492 (76%), Positives = 425/492 (86%), Gaps = 8/492 (1%)

Query: 1   MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVK 60
           MNC+ISGEVP EPVVS  SGLLFE+RLIERHI DYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct: 1   MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK 60

Query: 61  PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK 120
           P+ L  ASIPG+LG FQNEWDGLMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct: 61  PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK 120

Query: 121 ERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAE 180
           ERDEAR LLA+ ER I PA   AVT+NAALSNGKRA  DE+LGP  KKL  GI+  II E
Sbjct: 121 ERDEARQLLAEVERHI-PAAPEAVTANAALSNGKRAAVDEELGPDAKKLCPGISAEIITE 179

Query: 181 LTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIAT 240
           LTDCNAALSQ+RKKRQ+P  LA ID LER+TQL+SHPLHKT+KPGI S+DI +SKDVIAT
Sbjct: 180 LTDCNAALSQKRKKRQIPQTLASIDTLERFTQLSSHPLHKTNKPGICSMDILHSKDVIAT 239

Query: 241 GGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNY 300
           GGVD  AVLFDRPSGQI++TL+GHSKKVTSVKFV + DL LT SADKTVR+W+   DGNY
Sbjct: 240 GGVDATAVLFDRPSGQILSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNY 299

Query: 301 DCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGY 360
            C +TL DH+AEV+AVTVH TNKYFV+ASLD TWCFYDLSSG CL QVSD   D +   Y
Sbjct: 300 ACGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCFYDLSSGSCLAQVSD---DSKNVDY 356

Query: 361 TSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHD 420
           T+AAFHPDGLILGTGTS+++VKIWDVKSQANVAKFDGH G VTAISFSENGY+LATAA D
Sbjct: 357 TAAAFHPDGLILGTGTSQSVVKIWDVKSQANVAKFDGHTGEVTAISFSENGYFLATAAED 416

Query: 421 GVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIK 480
           GV+LWDLRKL+NF+SF S+D+    NSV+FD SGSYL +A++DI+VYQ ASVKA+WN IK
Sbjct: 417 GVRLWDLRKLRNFKSFLSADA----NSVEFDPSGSYLGIAASDIKVYQTASVKAEWNLIK 472

Query: 481 TFPDLSGTGAAS 492
           T PDLSGTG A+
Sbjct: 473 TLPDLSGTGKAT 484




Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immnunity. Functions as U-box E3 ubiquitin-protein ligase. May also serve as a support for spliceosome binding and activity.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9AV81|PUB72_ORYSJ U-box domain-containing protein 72 OS=Oryza sativa subsp. japonica GN=PUB72 PE=2 SV=1 Back     alignment and function description
>sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 Back     alignment and function description
>sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 Back     alignment and function description
>sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 Back     alignment and function description
>sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=2 SV=2 Back     alignment and function description
>sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 Back     alignment and function description
>sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 homolog OS=Caenorhabditis elegans GN=T10F2.4 PE=3 SV=2 Back     alignment and function description
>sp|Q7KWK5|PRP19_DICDI Pre-mRNA-processing factor 19 homolog OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
225433255524 PREDICTED: U-box domain-containing prote 0.970 0.933 0.843 0.0
356575233525 PREDICTED: U-box domain-containing prote 0.966 0.927 0.828 0.0
224099977524 predicted protein [Populus trichocarpa] 0.974 0.937 0.826 0.0
356534898525 PREDICTED: U-box domain-containing prote 0.966 0.927 0.820 0.0
224107501524 predicted protein [Populus trichocarpa] 0.970 0.933 0.815 0.0
449432512522 PREDICTED: U-box domain-containing prote 0.968 0.934 0.820 0.0
255574905531 Pre-mRNA-splicing factor, putative [Rici 0.976 0.926 0.806 0.0
388505970521 unknown [Medicago truncatula] 0.966 0.934 0.782 0.0
357439701519 Pre-mRNA-processing factor-like protein 0.960 0.932 0.777 0.0
297826789552 transducin family protein [Arabidopsis l 0.976 0.891 0.762 0.0
>gi|225433255|ref|XP_002285452.1| PREDICTED: U-box domain-containing protein 72 [Vitis vinifera] gi|296083725|emb|CBI23714.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/493 (84%), Positives = 454/493 (92%), Gaps = 4/493 (0%)

Query: 1   MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVK 60
           MNCS+SGEVPEEPVVSK SGLLFEKRLIERHI DYGKCP+TGEPLTMDDIVPI+TGKIVK
Sbjct: 1   MNCSMSGEVPEEPVVSKKSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIQTGKIVK 60

Query: 61  PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK 120
           PRP+ AASIPGMLGMFQ EWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct: 61  PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK 120

Query: 121 ERDEARSLLAQSERQIMPAESTAVTSNA-ALSNGKRAPEDEDLGPAGKKLHTGITPAIIA 179
           ERDEARSLLAQSERQI  + STA   NA ALSNGKRA EDE+LGP GKKL  GI+ +II 
Sbjct: 121 ERDEARSLLAQSERQIPMSMSTATAVNASALSNGKRAAEDEELGPNGKKLRPGISASIIT 180

Query: 180 ELTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIA 239
           ELTDCNAALSQQRKKRQ+P +LAPIDA+ERYTQL+S+PLHKT+KPGI+S DI+YSKD+IA
Sbjct: 181 ELTDCNAALSQQRKKRQIPTSLAPIDAVERYTQLSSYPLHKTNKPGILSADIYYSKDIIA 240

Query: 240 TGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGN 299
           TGGVD NAVLFDR SGQI++TLSGHSKKVTSVKFVT+ DLFLT SADKTVRVWQGS++ N
Sbjct: 241 TGGVDANAVLFDRQSGQILSTLSGHSKKVTSVKFVTQDDLFLTASADKTVRVWQGSDNEN 300

Query: 300 YDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEG 359
           Y+C+H LKDHTAEVQAVTVHATN YFVTASLDNTWCFYDLSSG+CLTQV+DA      EG
Sbjct: 301 YNCRHILKDHTAEVQAVTVHATNNYFVTASLDNTWCFYDLSSGLCLTQVADASGS---EG 357

Query: 360 YTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAH 419
           YTSAAFHPDGLILGTGTSEALVKIWDVKSQANVA+FDGHVGAVTAISFSENGY+LATAAH
Sbjct: 358 YTSAAFHPDGLILGTGTSEALVKIWDVKSQANVARFDGHVGAVTAISFSENGYFLATAAH 417

Query: 420 DGVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCI 479
           DGVKLWDLRKL+NFR+F   DS T TNSV+FDHSG+YLA+A +DIRVYQVA+VK++WNCI
Sbjct: 418 DGVKLWDLRKLRNFRTFTPYDSNTATNSVEFDHSGNYLAIAGSDIRVYQVANVKSEWNCI 477

Query: 480 KTFPDLSGTGAAS 492
           KTFPDLSGTG A+
Sbjct: 478 KTFPDLSGTGKAT 490




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356575233|ref|XP_003555746.1| PREDICTED: U-box domain-containing protein 72 [Glycine max] Back     alignment and taxonomy information
>gi|224099977|ref|XP_002311694.1| predicted protein [Populus trichocarpa] gi|222851514|gb|EEE89061.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356534898|ref|XP_003535988.1| PREDICTED: U-box domain-containing protein 72-like [Glycine max] Back     alignment and taxonomy information
>gi|224107501|ref|XP_002314503.1| predicted protein [Populus trichocarpa] gi|222863543|gb|EEF00674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449432512|ref|XP_004134043.1| PREDICTED: U-box domain-containing protein 72-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255574905|ref|XP_002528359.1| Pre-mRNA-splicing factor, putative [Ricinus communis] gi|223532227|gb|EEF34031.1| Pre-mRNA-splicing factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388505970|gb|AFK41051.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439701|ref|XP_003590128.1| Pre-mRNA-processing factor-like protein [Medicago truncatula] gi|355479176|gb|AES60379.1| Pre-mRNA-processing factor-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297826789|ref|XP_002881277.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297327116|gb|EFH57536.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
UNIPROTKB|Q9AV81527 PUB72 "U-box domain-containing 0.960 0.918 0.756 3.9e-202
TAIR|locus:2051094525 MAC3B "MOS4-associated complex 0.960 0.921 0.768 2.8e-201
TAIR|locus:2018319523 MAC3A "AT1G04510" [Arabidopsis 0.962 0.927 0.752 1.2e-200
UNIPROTKB|Q9UMS4504 PRPF19 "Pre-mRNA-processing fa 0.934 0.934 0.465 8.6e-104
UNIPROTKB|B2CCY7504 PRPF19 "Nuclear matrix protein 0.934 0.934 0.463 2.3e-103
UNIPROTKB|Q08E38504 PRPF19 "Pre-mRNA-processing fa 0.934 0.934 0.463 2.3e-103
ZFIN|ZDB-GENE-030131-263505 prp19 "PRP19/PSO4 homolog (S. 0.932 0.930 0.457 2.9e-103
UNIPROTKB|E2R8L3513 PRPF19 "Uncharacterized protei 0.934 0.918 0.461 2.9e-103
MGI|MGI:106247504 Prpf19 "PRP19/PSO4 pre-mRNA pr 0.934 0.934 0.461 4.7e-103
RGD|708496504 Prpf19 "PRP19/PSO4 pre-mRNA pr 0.934 0.934 0.461 4.7e-103
UNIPROTKB|Q9AV81 PUB72 "U-box domain-containing protein 72" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1956 (693.6 bits), Expect = 3.9e-202, P = 3.9e-202
 Identities = 370/489 (75%), Positives = 427/489 (87%)

Query:     1 MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVK 60
             M C+ISGEVP+EPVVSK SGLLFE+RL+ER+I D+GKCPVT E LTMDDIV +KT K+VK
Sbjct:     1 MICAISGEVPDEPVVSKKSGLLFERRLVERYIEDHGKCPVTKEELTMDDIVAVKTNKVVK 60

Query:    61 PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK 120
             PR L AASIPG+LGMFQNEWD +MLS+FALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct:    61 PRQLQAASIPGLLGMFQNEWDAIMLSSFALEQQLHTARQELSHALYQHDAACRVIARLKK 120

Query:   121 ERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDEDLGPAGKKLHTGITPAIIAE 180
             ERDEAR+LLAQ+ERQI PA        A +SNGKRA EDE +GP GKK+  GI P +I E
Sbjct:   121 ERDEARALLAQAERQI-PASMAGAAPTAVVSNGKRAFEDE-VGPDGKKIRPGINPVMIDE 178

Query:   181 LTDCNAALSQQRKKRQVPPALAPIDALERYTQLASHPLHKTSKPGIVSLDIHYSKDVIAT 240
             LT+CN  LS  RKKRQVPP LA IDA+ERYTQ++SHPLHKT+KPGI+S+DIH SKD+IAT
Sbjct:   179 LTECNTMLSAHRKKRQVPPTLASIDAIERYTQISSHPLHKTNKPGILSMDIHPSKDIIAT 238

Query:   241 GGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNY 300
             GG+DTNAVLFDRPSGQI+ TL+GHSKK+TS+KFV   +LF+TGSADKTV++WQGSE+GNY
Sbjct:   239 GGIDTNAVLFDRPSGQILCTLTGHSKKITSLKFVPRDELFVTGSADKTVKIWQGSEEGNY 298

Query:   301 DCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGY 360
             +C HTLKDHTAEV+AVTVHAT KYFVTAS DNTWCFYD+ SG CLTQV ++   G+ EGY
Sbjct:   299 NCIHTLKDHTAEVEAVTVHATQKYFVTASKDNTWCFYDIPSGSCLTQVGESS--GQ-EGY 355

Query:   361 TSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHD 420
             TSA+FHPDGLILGTGT+EA+VKIWDVK+Q+NVAKF+GHVG VTA+SFSENGY+LATAA D
Sbjct:   356 TSASFHPDGLILGTGTTEAVVKIWDVKTQSNVAKFEGHVGPVTAMSFSENGYFLATAALD 415

Query:   421 GVKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADWNCIK 480
             GVKLWDLRKL+NFR+    DS+TPTNSV+FD SGSYLAV  +D RVYQVA+VK +WN +K
Sbjct:   416 GVKLWDLRKLRNFRTISPYDSDTPTNSVEFDFSGSYLAVGGSDTRVYQVANVKLEWNLVK 475

Query:   481 TFPDLSGTG 489
             T PDLSGTG
Sbjct:   476 TLPDLSGTG 484


GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
TAIR|locus:2051094 MAC3B "MOS4-associated complex 3B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018319 MAC3A "AT1G04510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UMS4 PRPF19 "Pre-mRNA-processing factor 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B2CCY7 PRPF19 "Nuclear matrix protein 200" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E38 PRPF19 "Pre-mRNA-processing factor 19" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-263 prp19 "PRP19/PSO4 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8L3 PRPF19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:106247 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708496 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94BR4PR19A_ARATH6, ., 3, ., 2, ., -0.75200.96230.9273nono
Q5ZMA2PRP19_CHICKNo assigned EC number0.45070.93450.9326yesno
O22785PR19B_ARATH6, ., 3, ., 2, ., -0.76820.96030.9219yesno
Q9UMS4PRP19_HUMANNo assigned EC number0.46570.93450.9345yesno
Q9JMJ4PRP19_RATNo assigned EC number0.46160.93450.9345yesno
Q99KP6PRP19_MOUSENo assigned EC number0.46160.93450.9345yesno
Q7KWK5PRP19_DICDINo assigned EC number0.38470.90270.8852yesno
Q9AV81PUB72_ORYSJ6, ., 3, ., 2, ., -0.75200.96620.9240yesno
Q08E38PRP19_BOVINNo assigned EC number0.46370.93450.9345yesno
Q10051PRP19_CAEELNo assigned EC number0.40810.90270.9247yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-47
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-43
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-41
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-39
pfam0860670 pfam08606, Prp19, Prp19/Pso4-like 1e-35
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-28
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-25
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-24
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-22
smart0050463 smart00504, Ubox, Modified RING finger domain 5e-19
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-08
smart0032040 smart00320, WD40, WD40 repeats 1e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-07
smart0032040 smart00320, WD40, WD40 repeats 9e-07
smart0032040 smart00320, WD40, WD40 repeats 8e-06
pfam0456473 pfam04564, U-box, U-box domain 2e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 4e-05
COG5170460 COG5170, CDC55, Serine/threonine protein phosphata 1e-04
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  165 bits (420), Expect = 3e-47
 Identities = 78/262 (29%), Positives = 130/262 (49%), Gaps = 17/262 (6%)

Query: 225 GIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGS 284
           G+  +       ++ATG  D    ++D  +G+++ TL GH+  V  V    +G    +GS
Sbjct: 11  GVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGS 70

Query: 285 ADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGIC 344
           +DKT+R+W        +C  TL  HT+ V +V      +   ++S D T   +D+ +G C
Sbjct: 71  SDKTIRLWDLETG---ECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKC 127

Query: 345 LTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDGHVGAVTA 404
           LT +      G  +   S AF PDG  + + + +  +K+WD+++   VA   GH G V +
Sbjct: 128 LTTLR-----GHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNS 182

Query: 405 ISFSENGYYLATAAHDG-VKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASAD 463
           ++FS +G  L +++ DG +KLWDL   K   +    ++    NSV F   G  LA  S D
Sbjct: 183 VAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHEN--GVNSVAFSPDGYLLASGSED 240

Query: 464 --IRVYQVASVKADWNCIKTFP 483
             IRV+ + +      C++T  
Sbjct: 241 GTIRVWDLRT----GECVQTLS 258


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|203998 pfam08606, Prp19, Prp19/Pso4-like Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|227498 COG5170, CDC55, Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 504
KOG0289506 consensus mRNA splicing factor [General function p 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
PF0860670 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This r 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0288459 consensus WD40 repeat protein TipD [General functi 100.0
KOG0310 487 consensus Conserved WD40 repeat-containing protein 100.0
KOG0300481 consensus WD40 repeat-containing protein [Function 100.0
KOG0283 712 consensus WD40 repeat-containing protein [Function 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0643327 consensus Translation initiation factor 3, subunit 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.98
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.98
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.98
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.98
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.98
PTZ00420 568 coronin; Provisional 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.97
KOG0294362 consensus WD40 repeat-containing protein [Function 99.97
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.97
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.96
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.96
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.96
KOG0641350 consensus WD40 repeat protein [General function pr 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.95
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.95
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.95
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.95
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.95
KOG0646476 consensus WD40 repeat protein [General function pr 99.95
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.94
KOG0267 825 consensus Microtubule severing protein katanin p80 99.94
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.94
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.94
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.94
KOG2096420 consensus WD40 repeat protein [General function pr 99.94
KOG1274 933 consensus WD40 repeat protein [General function pr 99.94
KOG1273405 consensus WD40 repeat protein [General function pr 99.94
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.94
KOG0639705 consensus Transducin-like enhancer of split protei 99.94
KOG0267 825 consensus Microtubule severing protein katanin p80 99.93
KOG0302440 consensus Ribosome Assembly protein [General funct 99.93
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.93
KOG2055514 consensus WD40 repeat protein [General function pr 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.93
KOG2048 691 consensus WD40 repeat protein [General function pr 99.93
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG4283397 consensus Transcription-coupled repair protein CSA 99.92
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.92
KOG0639705 consensus Transducin-like enhancer of split protei 99.92
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.92
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.92
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.91
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.91
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.91
KOG0270463 consensus WD40 repeat-containing protein [Function 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.91
KOG1539 910 consensus WD repeat protein [General function pred 99.91
KOG2106626 consensus Uncharacterized conserved protein, conta 99.91
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.9
KOG0646 476 consensus WD40 repeat protein [General function pr 99.9
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.9
KOG1539 910 consensus WD repeat protein [General function pred 99.89
KOG4283397 consensus Transcription-coupled repair protein CSA 99.89
KOG1274 933 consensus WD40 repeat protein [General function pr 99.89
KOG2055514 consensus WD40 repeat protein [General function pr 99.89
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.89
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.89
KOG4328498 consensus WD40 protein [Function unknown] 99.89
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.88
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.88
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.88
KOG0302440 consensus Ribosome Assembly protein [General funct 99.87
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.87
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.86
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.86
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.86
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.86
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.86
KOG2048 691 consensus WD40 repeat protein [General function pr 99.85
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.85
KOG0270463 consensus WD40 repeat-containing protein [Function 99.85
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.85
KOG4328498 consensus WD40 protein [Function unknown] 99.84
KOG1273405 consensus WD40 repeat protein [General function pr 99.84
KOG2096420 consensus WD40 repeat protein [General function pr 99.84
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.84
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.84
COG2319 466 FOG: WD40 repeat [General function prediction only 99.83
KOG1188376 consensus WD40 repeat protein [General function pr 99.83
KOG0649325 consensus WD40 repeat protein [General function pr 99.82
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.82
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.82
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.82
PRK11028330 6-phosphogluconolactonase; Provisional 99.82
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.81
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.81
KOG4227 609 consensus WD40 repeat protein [General function pr 99.8
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.8
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.8
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.79
PRK01742429 tolB translocation protein TolB; Provisional 99.78
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.78
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.78
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.78
COG2319466 FOG: WD40 repeat [General function prediction only 99.78
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.78
PRK11028330 6-phosphogluconolactonase; Provisional 99.77
KOG0771398 consensus Prolactin regulatory element-binding pro 99.77
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.77
KOG1963 792 consensus WD40 repeat protein [General function pr 99.77
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.76
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.75
KOG0649325 consensus WD40 repeat protein [General function pr 99.75
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.75
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.74
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.74
KOG1310 758 consensus WD40 repeat protein [General function pr 99.74
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.74
KOG0771398 consensus Prolactin regulatory element-binding pro 99.73
KOG2110391 consensus Uncharacterized conserved protein, conta 99.73
KOG2139445 consensus WD40 repeat protein [General function pr 99.72
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.71
PRK01742429 tolB translocation protein TolB; Provisional 99.71
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.71
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.7
KOG1188376 consensus WD40 repeat protein [General function pr 99.7
KOG2111346 consensus Uncharacterized conserved protein, conta 99.69
KOG1334 559 consensus WD40 repeat protein [General function pr 99.69
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.68
PRK03629429 tolB translocation protein TolB; Provisional 99.68
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.67
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.67
KOG1310 758 consensus WD40 repeat protein [General function pr 99.66
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.66
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.65
KOG2321 703 consensus WD40 repeat protein [General function pr 99.65
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.64
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.64
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.63
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.63
PRK03629429 tolB translocation protein TolB; Provisional 99.63
KOG1963 792 consensus WD40 repeat protein [General function pr 99.63
PRK04922433 tolB translocation protein TolB; Provisional 99.63
KOG4227 609 consensus WD40 repeat protein [General function pr 99.63
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.62
PRK02889427 tolB translocation protein TolB; Provisional 99.62
PRK05137435 tolB translocation protein TolB; Provisional 99.61
PRK02889427 tolB translocation protein TolB; Provisional 99.61
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 99.61
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.61
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.6
PRK04922433 tolB translocation protein TolB; Provisional 99.6
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.59
KOG2111346 consensus Uncharacterized conserved protein, conta 99.59
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.58
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.58
PRK05137435 tolB translocation protein TolB; Provisional 99.58
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.58
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.57
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.56
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.56
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 99.55
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.53
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.53
KOG2139 445 consensus WD40 repeat protein [General function pr 99.52
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.51
PRK00178430 tolB translocation protein TolB; Provisional 99.49
KOG4547 541 consensus WD40 repeat-containing protein [General 99.47
PRK00178430 tolB translocation protein TolB; Provisional 99.46
PRK04792448 tolB translocation protein TolB; Provisional 99.46
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.46
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.45
KOG4547 541 consensus WD40 repeat-containing protein [General 99.45
PRK04792448 tolB translocation protein TolB; Provisional 99.44
KOG1334 559 consensus WD40 repeat protein [General function pr 99.43
PRK01029428 tolB translocation protein TolB; Provisional 99.42
KOG2315 566 consensus Predicted translation initiation factor 99.4
KOG2321 703 consensus WD40 repeat protein [General function pr 99.4
PRK01029428 tolB translocation protein TolB; Provisional 99.39
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.38
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.36
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.35
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.35
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.35
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.34
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.34
KOG2314 698 consensus Translation initiation factor 3, subunit 99.34
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.34
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.33
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.32
KOG2315 566 consensus Predicted translation initiation factor 99.3
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 99.28
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.26
KOG1409404 consensus Uncharacterized conserved protein, conta 99.25
KOG1354 433 consensus Serine/threonine protein phosphatase 2A, 99.25
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.25
KOG1409404 consensus Uncharacterized conserved protein, conta 99.24
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.23
COG4946 668 Uncharacterized protein related to the periplasmic 99.23
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.19
KOG2314698 consensus Translation initiation factor 3, subunit 99.18
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 99.16
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.15
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.14
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.12
PRK04043419 tolB translocation protein TolB; Provisional 99.12
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.12
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.11
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.11
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.1
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.08
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 99.07
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.06
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.06
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.05
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.05
PRK04043419 tolB translocation protein TolB; Provisional 99.04
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.98
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.97
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.97
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.96
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.96
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.95
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.94
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.93
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.93
COG4946668 Uncharacterized protein related to the periplasmic 98.92
KOG2695425 consensus WD40 repeat protein [General function pr 98.92
KOG2695425 consensus WD40 repeat protein [General function pr 98.91
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.9
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.87
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.86
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.85
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.84
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.83
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.81
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.76
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.75
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.72
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.67
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.66
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.66
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.64
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.63
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.6
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.55
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.54
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.5
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.45
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.44
KOG3621 726 consensus WD40 repeat-containing protein [General 98.4
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.4
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.37
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.35
KOG3621 726 consensus WD40 repeat-containing protein [General 98.35
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.34
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.34
PRK02888 635 nitrous-oxide reductase; Validated 98.34
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.33
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.28
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.28
PRK02888 635 nitrous-oxide reductase; Validated 98.27
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.26
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.24
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.23
KOG0883518 consensus Cyclophilin type, U box-containing pepti 98.22
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.22
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.2
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.17
COG3391381 Uncharacterized conserved protein [Function unknow 98.16
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.16
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.14
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.14
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.13
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.09
COG3391381 Uncharacterized conserved protein [Function unknow 98.07
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.06
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.04
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.0
KOG3039303 consensus Uncharacterized conserved protein [Funct 98.0
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.96
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.96
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.95
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.93
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.9
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.84
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 97.76
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.75
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.68
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.65
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.64
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.63
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.61
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.59
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.57
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.55
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.55
KOG2395644 consensus Protein involved in vacuole import and d 97.54
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.53
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.53
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.48
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.46
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.45
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.43
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.43
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.42
PRK13616591 lipoprotein LpqB; Provisional 97.41
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.4
KOG0287442 consensus Postreplication repair protein RAD18 [Re 97.4
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.4
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.37
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.32
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.31
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.3
PHA02713557 hypothetical protein; Provisional 97.28
PF04641260 Rtf2: Rtf2 RING-finger 97.28
KOG2979262 consensus Protein involved in DNA repair [General 97.27
PHA02713557 hypothetical protein; Provisional 97.26
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.22
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.21
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.2
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.19
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.17
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.14
PRK13616591 lipoprotein LpqB; Provisional 97.14
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.12
KOG2444238 consensus WD40 repeat protein [General function pr 97.09
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.06
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.03
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.99
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.99
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.95
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 96.91
PF04641260 Rtf2: Rtf2 RING-finger 96.87
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.87
PRK10115 686 protease 2; Provisional 96.86
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.85
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.84
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.74
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.74
PHA03098534 kelch-like protein; Provisional 96.73
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.72
KOG2395644 consensus Protein involved in vacuole import and d 96.69
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.69
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 96.69
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 96.68
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 96.67
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.66
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.64
PHA03098534 kelch-like protein; Provisional 96.62
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.6
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.54
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.51
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.45
KOG2444238 consensus WD40 repeat protein [General function pr 96.45
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.43
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.4
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 96.36
PHA02790480 Kelch-like protein; Provisional 96.34
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.3
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.27
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.21
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.21
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.2
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.17
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.15
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.14
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 96.07
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 96.06
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.99
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.91
PRK13684334 Ycf48-like protein; Provisional 95.9
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 95.8
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 95.71
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 95.68
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.63
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.61
COG5276370 Uncharacterized conserved protein [Function unknow 95.56
KOG3113293 consensus Uncharacterized conserved protein [Funct 95.47
PRK13684334 Ycf48-like protein; Provisional 95.37
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 95.32
COG5276370 Uncharacterized conserved protein [Function unknow 95.31
PF1463444 zf-RING_5: zinc-RING finger domain 95.26
COG5167776 VID27 Protein involved in vacuole import and degra 95.13
PF06416113 DUF1076: Protein of unknown function (DUF1076); In 95.07
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 95.01
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.94
PLN00033398 photosystem II stability/assembly factor; Provisio 94.87
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.81
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.76
KOG2660331 consensus Locus-specific chromosome binding protei 94.74
COG5167 776 VID27 Protein involved in vacuole import and degra 94.72
KOG0297391 consensus TNF receptor-associated factor [Signal t 94.63
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.47
PRK10115 686 protease 2; Provisional 94.46
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 94.46
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.45
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 94.23
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 94.17
KOG2377 657 consensus Uncharacterized conserved protein [Funct 94.16
PF13449326 Phytase-like: Esterase-like activity of phytase 94.11
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 94.04
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 94.02
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.99
PLN02153341 epithiospecifier protein 93.84
PF02333 381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 93.81
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.79
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.75
KOG2247 615 consensus WD40 repeat-containing protein [General 93.55
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 93.54
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.44
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.35
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.22
PHA02790480 Kelch-like protein; Provisional 93.09
PF13449326 Phytase-like: Esterase-like activity of phytase 93.07
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.86
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 92.8
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.8
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.6
PF07795214 DUF1635: Protein of unknown function (DUF1635); In 92.59
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 92.57
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=5.9e-109  Score=751.60  Aligned_cols=486  Identities=53%  Similarity=0.798  Sum_probs=438.1

Q ss_pred             CccccCCCCCCCceEeCCCCeeeeHHHHHHHHHhcCCCCCCCCCCCCCccccccCCCccCCCCCCCCChhhHHHhhhhhh
Q 010669            1 MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPLTAASIPGMLGMFQNEW   80 (504)
Q Consensus         1 ~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~sip~ll~~~q~Ew   80 (504)
                      |+|+||||+|++|||||+||++||||||||||.++|+||||++||+++|||+||.+..++||||+++|||+||++|||||
T Consensus         1 m~CaISgEvP~~PVvS~~Sg~vfEkrLIEqyI~e~G~DPIt~~pLs~eelV~Ik~~~~v~pk~~satSIPalL~~lQdEW   80 (506)
T KOG0289|consen    1 MVCAISGEVPEEPVVSPVSGHVFEKRLIEQYIAETGKDPITNEPLSIEELVEIKVPAQVRPKPPSATSIPALLKTLQDEW   80 (506)
T ss_pred             CeecccCCCCCCccccccccchHHHHHHHHHHHHcCCCCCCCCcCCHHHeeeccccccccCCCCCccchHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999899999999999999999999999


Q ss_pred             HHHHHhhhhhHHHHHHHHHHHhHhhhcccchhHHHHHHhcchhHHHHHHHHHhhhcCcccccccchhhhhcCCCCCCCCC
Q 010669           81 DGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLAQSERQIMPAESTAVTSNAALSNGKRAPEDE  160 (504)
Q Consensus        81 da~~le~~~lr~~l~~~~~els~aly~~daa~rv~a~l~kErd~ar~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (504)
                      |++|||+|+||+||+.+|||||||||||||||||||||.|||++||++|+++..+.+.............+...     .
T Consensus        81 DavML~~F~LRqqL~ttrQELShaLYqhDAAcrViaRL~kE~~eareaLa~~~~qa~a~~peav~~~~~~s~~~-----v  155 (506)
T KOG0289|consen   81 DAVMLESFTLRQQLQTTRQELSHALYQHDAACRVIARLTKERDEAREALAKLSPQAGAIVPEAVPSLAQSSVVG-----V  155 (506)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhhcCcccccccccccccccccchhh-----h
Confidence            99999999999999999999999999999999999999999999999999999887754322211111111111     1


Q ss_pred             cCCcCccccCCCCCHHHHHHHHHHHHHHHHhhccc--CCCCCCCChhHHhhccccceec-cccCCCCCeEEEEeccCCCE
Q 010669          161 DLGPAGKKLHTGITPAIIAELTDCNAALSQQRKKR--QVPPALAPIDALERYTQLASHP-LHKTSKPGIVSLDIHYSKDV  237 (504)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~~~--~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~I~~~~~s~~~~~  237 (504)
                      +++....  ..|+.+.++..+.+....|++.||+|  +.|+.++..+.+..|.+...+. +|.....+|.++...+..+.
T Consensus       156 a~ge~~d--~~g~s~~i~~~l~~~aq~ls~~rKkrg~k~p~~la~~d~~~~~~q~ash~gLH~t~~pgi~ald~~~s~~~  233 (506)
T KOG0289|consen  156 AAGESED--QPGLSPEIIQKLEDKAQVLSQERKKRGKKLPEKLATTDELSCLLQVASHTGLHSTSTPGITALDIIPSSSK  233 (506)
T ss_pred             hcCCccc--cccCCHHHHHHHHHHHHHHHHHhhhccccCCcccccHHHHHHHHhcCCCcceeccCCCCeeEEeecCCCCc
Confidence            1111111  24789999999999999999999999  8899999999999999999998 88888999999999998889


Q ss_pred             EEEEeCCCcEEEEcCCCCceEEEcccCccceeEEEEeeCCCEEEEEeCCCcEEEEeCCCCCCcceeEEeccCCcCeEEEE
Q 010669          238 IATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVT  317 (504)
Q Consensus       238 l~sg~~dg~i~vwd~~~~~~~~~~~~h~~~v~~l~~s~~~~~l~s~s~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~l~  317 (504)
                      +++|+.|..+.++|...++.+.+++||...|+.+.|+++...+++++.|..|+||.....   .+......|..+|+.+.
T Consensus       234 ilTGG~d~~av~~d~~s~q~l~~~~Gh~kki~~v~~~~~~~~v~~aSad~~i~vws~~~~---s~~~~~~~h~~~V~~ls  310 (506)
T KOG0289|consen  234 ILTGGEDKTAVLFDKPSNQILATLKGHTKKITSVKFHKDLDTVITASADEIIRVWSVPLS---SEPTSSRPHEEPVTGLS  310 (506)
T ss_pred             ceecCCCCceEEEecchhhhhhhccCcceEEEEEEeccchhheeecCCcceEEeeccccc---cCccccccccccceeee
Confidence            999999999999999999999999999999999999999999999999999999998765   45566678999999999


Q ss_pred             EccCCCEEEEEeCCCeEEEEECCCCeEEEEeecCCCCCCCCCeEEEEECCCCCEEEEEeCCCcEEEEEcCCCceeeeeeC
Q 010669          318 VHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKIWDVKSQANVAKFDG  397 (504)
Q Consensus       318 ~~p~~~~l~s~s~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~~~~~pdg~~l~~g~~dg~I~iwd~~~~~~~~~~~~  397 (504)
                      .||.|.||++++.||++.+.|++++..+......   ...-.+++.+|||||.+|++|..||.|+|||++++..+..|.+
T Consensus       311 ~h~tgeYllsAs~d~~w~Fsd~~~g~~lt~vs~~---~s~v~~ts~~fHpDgLifgtgt~d~~vkiwdlks~~~~a~Fpg  387 (506)
T KOG0289|consen  311 LHPTGEYLLSASNDGTWAFSDISSGSQLTVVSDE---TSDVEYTSAAFHPDGLIFGTGTPDGVVKIWDLKSQTNVAKFPG  387 (506)
T ss_pred             eccCCcEEEEecCCceEEEEEccCCcEEEEEeec---cccceeEEeeEcCCceEEeccCCCceEEEEEcCCccccccCCC
Confidence            9999999999999999999999999988877632   3345799999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEEcCCCcEEEEEeCCc-EEEEEcCCCcceeeeecCCCCCCeeEEEECCCCCEEEEEeCcEEEEEeeccCccc
Q 010669          398 HVGAVTAISFSENGYYLATAAHDG-VKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSYLAVASADIRVYQVASVKADW  476 (504)
Q Consensus       398 ~~~~i~~l~~s~~g~~l~s~~~d~-v~vwd~~~~~~~~~~~~~~~~~~v~~i~~~~~g~~l~~~~~di~vw~~~~~~~~~  476 (504)
                      |.++|..++|+.||+||+++++|+ |++||+|+.+.++++.... ..++.++.|++.|.||+.+|.+++||.+.+.++.|
T Consensus       388 ht~~vk~i~FsENGY~Lat~add~~V~lwDLRKl~n~kt~~l~~-~~~v~s~~fD~SGt~L~~~g~~l~Vy~~~k~~k~W  466 (506)
T KOG0289|consen  388 HTGPVKAISFSENGYWLATAADDGSVKLWDLRKLKNFKTIQLDE-KKEVNSLSFDQSGTYLGIAGSDLQVYICKKKTKSW  466 (506)
T ss_pred             CCCceeEEEeccCceEEEEEecCCeEEEEEehhhcccceeeccc-cccceeEEEcCCCCeEEeecceeEEEEEecccccc
Confidence            999999999999999999999999 9999999999999998765 34899999999999999999999999998888999


Q ss_pred             eeEEEccCCCCCCceeEEEEeecCcc
Q 010669          477 NCIKTFPDLSGTGAASFLFLFVLGQT  502 (504)
Q Consensus       477 ~~i~~~~~h~~~~~v~~l~~~~~g~~  502 (504)
                      .++..+..|  .+..+++.|-..-|.
T Consensus       467 ~~~~~~~~~--sg~st~v~Fg~~aq~  490 (506)
T KOG0289|consen  467 TEIKELADH--SGLSTGVRFGEHAQY  490 (506)
T ss_pred             eeeehhhhc--ccccceeeecccceE
Confidence            999999998  677888888665543



>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PF08606 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This region is found specifically in PRP19-like protein Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74) Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07795 DUF1635: Protein of unknown function (DUF1635); InterPro: IPR012862 The members of this family include sequences that are parts of hypothetical proteins expressed by plant species Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-22
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-22
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-21
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-21
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-21
2gnq_A336 Structure Of Wdr5 Length = 336 1e-21
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-21
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-21
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-21
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-21
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-21
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-21
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-21
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-21
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-21
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-21
2h9l_A329 Wdr5delta23 Length = 329 2e-21
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 5e-16
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 3e-15
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-14
2zkq_a 317 Structure Of A Mammalian Ribosomal 40s Subunit With 9e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 3e-14
3zey_7318 High-resolution Cryo-electron Microscopy Structure 5e-14
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-13
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-06
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 8e-04
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-13
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 3e-13
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-13
1vyh_C 410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-08
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-12
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-08
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-10
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 1e-10
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-10
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-10
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-10
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 2e-10
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-10
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-10
4ggd_A 431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-05
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 4e-10
4gga_A 420 Structural Analysis Of Human Cdc20 Supports Multi-S 4e-05
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 5e-10
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-09
4ggc_A 318 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-04
1n87_A56 Solution Structure Of The U-Box Of Prp19 Length = 5 4e-09
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 6e-09
2bay_A61 Crystal Structure Of The Prp19 U-Box Dimer Length = 6e-09
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 8e-09
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 9e-09
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 9e-09
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 9e-09
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 9e-09
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 2e-08
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 4e-06
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 3e-08
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 4e-08
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 1e-07
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-07
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-07
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-07
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-07
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-07
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 4e-07
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 7e-07
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-06
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 2e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 3e-06
2hes_X 330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 4e-04
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-05
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-05
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 5e-05
3dw8_B447 Structure Of A Protein Phosphatase 2a Holoenzyme Wi 6e-05
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 6e-05
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 8e-05
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure

Iteration: 1

Score = 102 bits (253), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 65/234 (27%), Positives = 124/234 (52%), Gaps = 16/234 (6%) Query: 252 RPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTA 311 +P+ ++ TL+GH+K V+SVKF G+ + SADK +++W G+ DG ++ T+ H Sbjct: 13 KPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIW-GAYDGKFE--KTISGHKL 69 Query: 312 EVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLI 371 + V + + V+AS D T +D+SSG CL + G F+P + Sbjct: 70 GISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLK-----GHSNYVFCCNFNPQSNL 124 Query: 372 LGTGTSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDGV-KLWDLRKL 430 + +G+ + V+IWDVK+ + H V+A+ F+ +G + ++++DG+ ++WD Sbjct: 125 IVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASG 184 Query: 431 KNFRSFESSDSETPTNSVDFDHSGSYLAVASA--DIRVYQVASVKADWNCIKTF 482 + ++ D+ P + V F +G Y+ A+ D++++ + K C+KT+ Sbjct: 185 QCLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNDLKLWDYSKGK----CLKTY 233
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|1N87|A Chain A, Solution Structure Of The U-Box Of Prp19 Length = 56 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2BAY|A Chain A, Crystal Structure Of The Prp19 U-Box Dimer Length = 61 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3DW8|B Chain B, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 447 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.98
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.98
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.98
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.93
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.92
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.92
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.92
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.91
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.91
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.9
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.9
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.87
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.87
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.87
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.85
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.84
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.84
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.83
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.82
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.82
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.81
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.81
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.81
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.8
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.79
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.78
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.76
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.75
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.75
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.74
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.73
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.73
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.73
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.72
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.72
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.71
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.69
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.69
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.68
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.67
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.65
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.65
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.62
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.62
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.61
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.6
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.59
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.58
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.56
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.56
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.55
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.55
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.54
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.53
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.53
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.52
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.51
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.51
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.49
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.48
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.47
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.47
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.47
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.46
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.46
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.45
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.43
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.41
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.41
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.39
2qe8_A343 Uncharacterized protein; structural genomics, join 99.35
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.35
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.3
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.29
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.29
2ece_A462 462AA long hypothetical selenium-binding protein; 99.28
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.27
2ece_A462 462AA long hypothetical selenium-binding protein; 99.2
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.18
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.18
2qe8_A343 Uncharacterized protein; structural genomics, join 99.17
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.16
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.14
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.13
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.12
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.11
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.11
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.09
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.07
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.06
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.06
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.05
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.04
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.03
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.03
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.0
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 98.99
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.97
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.97
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.96
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.95
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.94
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.94
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.88
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.87
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.84
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.83
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.81
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.8
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.77
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.76
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.75
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.7
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.69
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.69
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.67
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.67
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.66
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.66
3v65_B386 Low-density lipoprotein receptor-related protein; 98.66
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.64
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.63
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.62
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.61
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.59
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.58
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.55
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.55
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.54
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.54
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.53
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.53
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.53
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.52
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.5
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.5
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.49
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.49
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.48
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.48
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.48
3v65_B386 Low-density lipoprotein receptor-related protein; 98.48
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.47
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.46
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.46
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.43
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.43
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.43
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.42
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.42
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.39
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.38
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.37
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.36
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.35
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.35
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.35
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.35
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.34
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.33
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.33
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.3
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.29
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.29
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.29
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.28
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.27
3kya_A496 Putative phosphatase; structural genomics, joint c 98.27
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.25
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.23
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.21
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.19
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.16
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.15
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.13
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 98.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.07
2ect_A78 Ring finger protein 126; metal binding protein, st 98.07
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.0
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.99
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.99
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.93
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.92
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.92
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.92
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.92
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.9
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.89
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.89
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.85
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.83
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.83
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.81
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.8
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.8
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.75
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.69
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.68
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.68
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.65
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.6
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.56
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.52
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.46
3ott_A 758 Two-component system sensor histidine kinase; beta 97.46
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.44
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.42
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.41
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.39
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.38
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.35
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.33
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.31
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.3
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.29
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.29
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.27
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.23
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.2
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.17
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.05
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.02
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.95
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.94
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.93
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.92
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.86
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.81
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.79
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.78
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.62
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.61
3ott_A 758 Two-component system sensor histidine kinase; beta 96.61
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.54
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.53
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.52
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.47
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.41
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.37
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.33
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.31
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.22
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.15
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 96.08
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 95.95
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.87
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 95.84
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.71
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.67
2kkx_A102 Uncharacterized protein ECS2156; methods developme 95.61
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 95.59
2ea5_A68 Cell growth regulator with ring finger domain prot 95.53
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 95.28
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 95.18
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.84
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.27
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 94.25
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.87
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 91.88
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.34
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 89.36
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 89.13
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.78
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 87.45
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.02
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 86.19
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 85.9
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 84.74
3ra3_A28 P1C; coiled coil domain, fiber, KIH interactions, 83.87
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 83.44
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 83.44
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
Probab=100.00  E-value=1.8e-46  Score=366.50  Aligned_cols=272  Identities=21%  Similarity=0.323  Sum_probs=248.7

Q ss_pred             ccCCCCCeEEEEeccCCCEEEEEeCCCcEEEEcCCCCceEEEcccCccceeEEEEeeCCCEEEEEeCCCcEEEEeCCCCC
Q 010669          219 HKTSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQIVTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDG  298 (504)
Q Consensus       219 ~~~~~~~I~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~~~~h~~~v~~l~~s~~~~~l~s~s~dg~i~iwd~~~~~  298 (504)
                      ..+|...|++++|+|++++|++|+.||.|++||..+++.+..+..|...|.+++|+|++++|++|+.|+.|++|++.+..
T Consensus        51 l~gH~~~v~~~~~s~d~~~l~s~s~Dg~v~iWd~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~s~~~d~~v~iw~~~~~~  130 (340)
T 1got_B           51 LRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTRE  130 (340)
T ss_dssp             ECCCSSCEEEEEECTTSSEEEEEETTTEEEEEETTTCCEEEEEECSSSCEEEEEECTTSSEEEEEETTCEEEEEETTTCS
T ss_pred             ecCCCCceEEEEECCCCCEEEEEeCCCcEEEEECCCCCcceEeecCCccEEEEEECCCCCEEEEEeCCCeEEEEECccCC
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999997642


Q ss_pred             -CcceeEEeccCCcCeEEEEEccCCCEEEEEeCCCeEEEEECCCCeEEEEeecCCCCCCCCCeEEEEECCCCCEEEEEeC
Q 010669          299 -NYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTS  377 (504)
Q Consensus       299 -~~~~~~~~~~h~~~v~~l~~~p~~~~l~s~s~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~~~~~pdg~~l~~g~~  377 (504)
                       .......+.+|.+.|.++.|++++. +++++.|+.|++||+++++....+.     +|...|.+++|+|++.+|++|+.
T Consensus       131 ~~~~~~~~~~~h~~~v~~~~~~~~~~-l~s~s~d~~i~~wd~~~~~~~~~~~-----~h~~~v~~~~~~~~~~~l~sg~~  204 (340)
T 1got_B          131 GNVRVSRELAGHTGYLSCCRFLDDNQ-IVTSSGDTTCALWDIETGQQTTTFT-----GHTGDVMSLSLAPDTRLFVSGAC  204 (340)
T ss_dssp             BSCEEEEEEECCSSCEEEEEEEETTE-EEEEETTSCEEEEETTTTEEEEEEC-----CCSSCEEEEEECTTSSEEEEEET
T ss_pred             CcceeEEEecCCCccEEEEEECCCCc-EEEEECCCcEEEEECCCCcEEEEEc-----CCCCceEEEEECCCCCEEEEEeC
Confidence             2345567789999999999998765 8999999999999999999887775     67789999999999999999999


Q ss_pred             CCcEEEEEcCCCceeeeeeCCCCCeEEEEEcCCCcEEEEEeCCc-EEEEEcCCCcceeeeecCCCCCCeeEEEECCCCCE
Q 010669          378 EALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDG-VKLWDLRKLKNFRSFESSDSETPTNSVDFDHSGSY  456 (504)
Q Consensus       378 dg~I~iwd~~~~~~~~~~~~~~~~i~~l~~s~~g~~l~s~~~d~-v~vwd~~~~~~~~~~~~~~~~~~v~~i~~~~~g~~  456 (504)
                      ||.|++||++++..+..+.+|...|++++|+|+|.+|++|+.|+ |++||+++++.+..+........|.+++|+|+|++
T Consensus       205 d~~v~~wd~~~~~~~~~~~~h~~~v~~v~~~p~~~~l~s~s~d~~v~iwd~~~~~~~~~~~~~~~~~~v~~~~~s~~g~~  284 (340)
T 1got_B          205 DASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRL  284 (340)
T ss_dssp             TSCEEEEETTTCSEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCTTCCSCEEEEEECTTSSE
T ss_pred             CCcEEEEECCCCeeEEEEcCCcCCEEEEEEcCCCCEEEEEcCCCcEEEEECCCCcEEEEEccCCcccceEEEEECCCCCE
Confidence            99999999999999999999999999999999999999999998 99999999888777765444567999999999999


Q ss_pred             EEEEeCc--EEEEEeeccCccceeEEEccCCCCCCceeEEEEeecCcc
Q 010669          457 LAVASAD--IRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQT  502 (504)
Q Consensus       457 l~~~~~d--i~vw~~~~~~~~~~~i~~~~~h~~~~~v~~l~~~~~g~~  502 (504)
                      |++|+.|  |++||+    ..+..+..+.+|  .+.|++++|+|+|+.
T Consensus       285 l~~g~~d~~i~vwd~----~~~~~~~~~~~h--~~~v~~~~~s~dg~~  326 (340)
T 1got_B          285 LLAGYDDFNCNVWDA----LKADRAGVLAGH--DNRVSCLGVTDDGMA  326 (340)
T ss_dssp             EEEEETTSEEEEEET----TTCCEEEEEECC--SSCEEEEEECTTSSC
T ss_pred             EEEECCCCeEEEEEc----ccCcEeeEeecC--CCcEEEEEEcCCCCE
Confidence            9999998  999998    667888999999  889999999999964



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3ra3_A P1C; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 504
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-28
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-22
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-27
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-24
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-19
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-23
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-18
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-19
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-18
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-16
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-15
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-15
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-13
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-12
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-07
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-15
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-14
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-13
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 9e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 9e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-10
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 8e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-12
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-08
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-12
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 7e-10
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-07
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-11
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-08
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 7e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-10
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-06
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-04
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-09
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-07
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-09
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-05
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 4e-05
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 4e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 7e-05
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.002
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  112 bits (281), Expect = 3e-28
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 7/164 (4%)

Query: 264 HSKKVTSVKFVTEGDLFLTGSADKTVRVWQGSEDGNYDCKHTLKDHTAEVQAVTVHATNK 323
           H+  V S+    +  LF++G+ D + ++W         C+ T   H +++ A+       
Sbjct: 183 HTGDVMSLSLAPDTRLFVSGACDASAKLWDVR---EGMCRQTFTGHESDINAICFFPNGN 239

Query: 324 YFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTGTSEALVKI 383
            F T S D T   +D        ++     D    G TS +F   G +L  G  +    +
Sbjct: 240 AFATGSDDATCRLFD---LRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNV 296

Query: 384 WDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDG-VKLWD 426
           WD           GH   V+ +  +++G  +AT + D  +K+W+
Sbjct: 297 WDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.88
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.82
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.79
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.7
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.61
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.57
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.52
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.48
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.46
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.4
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.39
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.38
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.35
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.31
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.31
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.3
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.23
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.22
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.19
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.18
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.11
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.09
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.06
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.01
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.0
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.98
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.92
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.88
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.87
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.71
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.67
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.55
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.5
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.3
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.14
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.06
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.9
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.8
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.74
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.68
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.6
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.53
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.51
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.49
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.43
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.42
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.38
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.32
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.29
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 97.24
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.07
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.05
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.7
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.61
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.55
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 96.54
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 96.4
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 96.31
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.27
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.24
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.11
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.07
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.95
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 95.9
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.74
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.69
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.6
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.27
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.27
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.21
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.56
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 92.36
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.82
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 90.46
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 90.01
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 84.8
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.1e-37  Score=298.14  Aligned_cols=264  Identities=16%  Similarity=0.259  Sum_probs=231.7

Q ss_pred             CCCCCeEEEEeccCCCEEEEEeCCCcEEEEcCCCCce-----EEEcccCccceeEEEEeeCCCEEEEEeCCCcEEEEeCC
Q 010669          221 TSKPGIVSLDIHYSKDVIATGGVDTNAVLFDRPSGQI-----VTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQGS  295 (504)
Q Consensus       221 ~~~~~I~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~-----~~~~~~h~~~v~~l~~s~~~~~l~s~s~dg~i~iwd~~  295 (504)
                      .|...|+|++|+|+|++|++|+ ||.|+|||+.++..     .....+|.+.|.+++|+|++++|++|+.||+|++||+.
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~  127 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA  127 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECC
T ss_pred             CCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeeccccccccccc
Confidence            6889999999999999999997 89999999876532     33445799999999999999999999999999999987


Q ss_pred             CCCCcceeEEeccCCcCeEEEEEccCCCEEEEEeCCCeEEEEECCCCeEEEEeecCCCCCCCCCeEEEEECCCCCEEEEE
Q 010669          296 EDGNYDCKHTLKDHTAEVQAVTVHATNKYFVTASLDNTWCFYDLSSGICLTQVSDAGTDGRPEGYTSAAFHPDGLILGTG  375 (504)
Q Consensus       296 ~~~~~~~~~~~~~h~~~v~~l~~~p~~~~l~s~s~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~~~~~pdg~~l~~g  375 (504)
                      .. .......+..|...+.++.|+|++.++++++.|+.|++||+.+++......     .|...+.+++|++++..+++|
T Consensus       128 ~~-~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~-----~~~~~v~~l~~s~~~~~~~~~  201 (337)
T d1gxra_         128 AP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQ-----GHTDGASCIDISNDGTKLWTG  201 (337)
T ss_dssp             CC---EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEEC-----CCSSCEEEEEECTTSSEEEEE
T ss_pred             cc-ccccccccccccccccccccccccccccccccccccccccccccccccccc-----ccccccccccccccccccccc
Confidence            53 235566778899999999999999999999999999999999998877665     667889999999999999999


Q ss_pred             eCCCcEEEEEcCCCceeeeeeCCCCCeEEEEEcCCCcEEEEEeCCc-EEEEEcCCCcceeeeecCCCCCCeeEEEECCCC
Q 010669          376 TSEALVKIWDVKSQANVAKFDGHVGAVTAISFSENGYYLATAAHDG-VKLWDLRKLKNFRSFESSDSETPTNSVDFDHSG  454 (504)
Q Consensus       376 ~~dg~I~iwd~~~~~~~~~~~~~~~~i~~l~~s~~g~~l~s~~~d~-v~vwd~~~~~~~~~~~~~~~~~~v~~i~~~~~g  454 (504)
                      +.||.|++||+++++.+..+. |...|.+++|+|++.+|++++.++ |++||++++.....   ..+...|.+++|+|+|
T Consensus       202 ~~d~~v~i~d~~~~~~~~~~~-~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~---~~~~~~i~~v~~s~~g  277 (337)
T d1gxra_         202 GLDNTVRSWDLREGRQLQQHD-FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQL---HLHESCVLSLKFAYCG  277 (337)
T ss_dssp             ETTSEEEEEETTTTEEEEEEE-CSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEEE---CCCSSCEEEEEECTTS
T ss_pred             cccccccccccccceeecccc-cccceEEEEEcccccccceeccccccccccccccccccc---cccccccceEEECCCC
Confidence            999999999999999887776 788999999999999999999998 99999998776432   2346789999999999


Q ss_pred             CEEEEEeCc--EEEEEeeccCccceeEEEccCCCCCCceeEEEEeecCcc
Q 010669          455 SYLAVASAD--IRVYQVASVKADWNCIKTFPDLSGTGAASFLFLFVLGQT  502 (504)
Q Consensus       455 ~~l~~~~~d--i~vw~~~~~~~~~~~i~~~~~h~~~~~v~~l~~~~~g~~  502 (504)
                      ++|++++.|  |++|++    .+++.+..+. |  .+.|++++|+|+|+.
T Consensus       278 ~~l~s~s~Dg~i~iwd~----~~~~~~~~~~-~--~~~v~~~~~s~d~~~  320 (337)
T d1gxra_         278 KWFVSTGKDNLLNAWRT----PYGASIFQSK-E--SSSVLSCDISVDDKY  320 (337)
T ss_dssp             SEEEEEETTSEEEEEET----TTCCEEEEEE-C--SSCEEEEEECTTSCE
T ss_pred             CEEEEEeCCCeEEEEEC----CCCCEEEEcc-C--CCCEEEEEEeCCCCE
Confidence            999999998  999998    6677787764 5  689999999999874



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure