Citrus Sinensis ID: 010712

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500---

MGSKGRIPPPHLRRPPPGPGMMHPDPFVSGMRPPMPGAFPPFDMMPPPEVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMKSERELQMRNLTEKIAKMEAELKTAEPVKLEFQKSKTEAQNLVVAREELIAKVHQLTQDLQRAHTDVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSATPPARSGSGQPRGGNPARR

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

****************************************************************************************ELQILHG*********************************************NLVVAREELIAKVHQLTQDLQRAHTDVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKL****MNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSA*******TPMRAAYDIP*************************************************************************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSKGRIPPPHLRRPPPGPGMMHPDPFVSGMRPPMPGAFPPFDMMPPPEVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMxxxxxxxxxxxxxxxxxxxxxLKTAEPVKLEFQKSKTEAQNLVVAxxxxxxxxxxxxxxxxxxxxxVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESxxxxxxxxxxxxxxxxxxxxxLMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSATPPARSGSGQPRGGNPARR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 49-97
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:very confident
Coverage over the Query: 180-207
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 91-229
View the alignment between query and template
View the model in PyMOL

Template: 2XS1, chain A
Confidence level:confident
Coverage over the Query: 6-28
View the alignment between query and template
View the model in PyMOL

Template: 4F61, chain I
Confidence level:probable
Coverage over the Query: 33-234
View the alignment between query and template
View the model in PyMOL