Citrus Sinensis ID: 010723


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MFTRYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
ccCEEEEcccccHHHHcccccEEEEcHHHHHHHHHHHcccccEEccccEEEEEEcccEEEEEEccccEEEccEEEEcccccHHHHcccccccccccccEEEEEEEEccccccccccCEEEEEcccCEEEEEEccccEEEEEEEECccccccccccccHHHHHHHHccccHHHHHHHHccccccEEEEEccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccHHHccccHHHHHHHHcccccccccccccccccccccHHHHHcccccHHHHHHccccEEEEEccccccccccEEEccccccccEEEcccccccccccEEEEcccccccccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccEEEEcccccEEEEEEEEcccccccccccccccccccc
MFTRYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIG******FSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVI********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTRYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zeaxanthin epoxidase, chloroplastic Zeaxanthin epoxidase that plays an important role in the xanthophyll cycle and abscisic acid (ABA) biosynthesis. Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Required for resistance to osmotic and drought stresses, seed development and dormancy.probableQ0JCU7
Zeaxanthin epoxidase, chloroplastic Zeaxanthin epoxidase that plays an important role in the xanthophyll cycle and abscisic acid (ABA) biosynthesis. Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Required for resistance to osmotic and drought stresses, ABA-dependent stomatal closure, seed development and dormancy, modulation of defense gene expression and disease resistance and non-photochemical quencing (NPQ). Through its role in ABA biosynthesis, regulates the expression of stress-responsive genes such as RD29A during osmotic stress and is required for normal plant growth during vegetative development. Is required for late skotomorphogenic growth through its role in the xanthophyll carotenoids neoxanthin, violaxanthin and antheraxanthin biosynthesis. Required for beta-aminobutyric acid (BABA)-induced priming in disease resistance, tolerance to salt and drought stresses and sterility. Participates in NPQ by regulating the level of zeaxanthin in photosynthetic energy conversion. NPQ is a process that maintains the balance between dissipation and utilization of light energy to minimize the generation of oxidizing molecules and the molecular damages they can generate.probableQ9FGC7
Zeaxanthin epoxidase, chloroplastic Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Involved in the epoxidation of zeaxanthin.probableO81360

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.13.-With NADH or NADPH as one donor, and incorporation of one atom of oxygen.probable
1.14.13.90Zeaxanthin epoxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RP8, chain A
Confidence level:very confident
Coverage over the Query: 20-305
View the alignment between query and template
View the model in PyMOL
Template: 2KB3, chain A
Confidence level:very confident
Coverage over the Query: 359-481
View the alignment between query and template
View the model in PyMOL
Template: 3FMW, chain A
Confidence level:confident
Coverage over the Query: 18-324
View the alignment between query and template
View the model in PyMOL
Template: 3ELV, chain A
Confidence level:confident
Coverage over the Query: 352-473
View the alignment between query and template
View the model in PyMOL