Citrus Sinensis ID: 010754

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--

MSSITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLSNSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKEKERLDREKERERDKERVENEKEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILARLIPYFLYWICSIYFKYFGTTERANLPLHLACSDVEL

cccccccHHHHHHHHHHHHcccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccECcccccccEEEEEccccccccccccEEEEEEcccccEEEEccccccEEcccccccccccccccEEEEEEcccccEEEEEcccccEEEcccccccccccccccccccEEEEEcccccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEcccccccccEEEEEEccccEEEEECccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccccccccCEEEEccccccccccEEEEEEcccccccccccccccccccccc

**SITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLSNSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKEKERLDREKERERDKERVENEKEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILARLIPYFLYWICSIYFKYFGTTERANLPLHLACSDVEL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSITSEELNYLVFRYLQESGLLHSAFVLGYEAGINKCNIDGNLVPPRALITFVQKGLQYLEMEANLSNSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKExxxxxxxxxxxxxxxxxxxxxEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILARLIPYFLYWICSIYFKYFGTTERANLPLHLACSDVEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box-like/WD repeat-containing protein TBL1Y	F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.	probable	Q9BQ87

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOW, chain A
Confidence level:very confident
Coverage over the Query: 190-250,268-477
View the alignment between query and template
View the model in PyMOL

Template: 2XTC, chain A
Confidence level:very confident
Coverage over the Query: 3-76
View the alignment between query and template
View the model in PyMOL

Template: 2J04, chain A
Confidence level:confident
Coverage over the Query: 214-485
View the alignment between query and template
View the model in PyMOL