Citrus Sinensis ID: 010804
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 500 | ||||||
| 255545368 | 498 | protein disulfide isomerase, putative [R | 0.994 | 0.997 | 0.776 | 0.0 | |
| 11133775 | 498 | RecName: Full=Protein disulfide-isomeras | 0.994 | 0.997 | 0.772 | 0.0 | |
| 133902301 | 495 | putative protein disulfide isomerase [Go | 0.99 | 1.0 | 0.762 | 0.0 | |
| 225459587 | 499 | PREDICTED: protein disulfide-isomerase [ | 0.986 | 0.987 | 0.773 | 0.0 | |
| 356518549 | 556 | PREDICTED: LOW QUALITY PROTEIN: protein | 0.958 | 0.861 | 0.788 | 0.0 | |
| 224063066 | 505 | predicted protein [Populus trichocarpa] | 0.996 | 0.986 | 0.753 | 0.0 | |
| 351722359 | 525 | protein disulfide isomerase-like protein | 0.958 | 0.912 | 0.768 | 0.0 | |
| 118489117 | 505 | unknown [Populus trichocarpa x Populus d | 0.996 | 0.986 | 0.743 | 0.0 | |
| 133902323 | 495 | putative protein disulfide isomerase [Go | 0.99 | 1.0 | 0.764 | 0.0 | |
| 188509919 | 495 | putative protein disulfide [Gossypioides | 0.99 | 1.0 | 0.758 | 0.0 |
| >gi|255545368|ref|XP_002513744.1| protein disulfide isomerase, putative [Ricinus communis] gi|223546830|gb|EEF48327.1| protein disulfide isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 811 bits (2094), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 389/501 (77%), Positives = 444/501 (88%), Gaps = 4/501 (0%)
Query: 1 MASSR-SILALVLTIACCMTAISAEESAESKEFVLTLDHSNFSDTVSKHNFIVVEFYAPW 59
MAS R SI + ++ AISA ES E + VLTLD +NF+DT+SKH+FIVVEFYAPW
Sbjct: 1 MASFRGSIWYCIFVLSLIAVAISAAESEEEQSSVLTLDSTNFTDTISKHDFIVVEFYAPW 60
Query: 60 CGHCKKLAPEYEKAASELSSHDPPVVLAKVDANEEANKELASQYEIRGFPTIKILRNGGK 119
CGHCKKLAPEYEKAAS L SHD PVVLAKVDANEEANKELA+QY+I+GFPT+KILRNGGK
Sbjct: 61 CGHCKKLAPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGK 120
Query: 120 TIQEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFEN 179
+IQEYKGPREADGI EYLKKQSGPAS EIKS E A++FIG+KK+ I+GVFP FSGEE+EN
Sbjct: 121 SIQEYKGPREADGIAEYLKKQSGPASVEIKSTEAANTFIGDKKIFIVGVFPKFSGEEYEN 180
Query: 180 YTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLFKPFDELFVDFKDFKVDALEKFV 239
Y ++A+KLRSDYEFGHT +AK LP+GESSVTGPVVRLFKPFDELFVDFKDF VDALEKFV
Sbjct: 181 YMSVADKLRSDYEFGHTLDAKHLPQGESSVTGPVVRLFKPFDELFVDFKDFNVDALEKFV 240
Query: 240 EESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQ 299
EESS+P+VTVFNSD +NHPFVIKFFNSP+AKAMLFMNF+ E + I+SKY+EVA Q+KG+
Sbjct: 241 EESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGE 300
Query: 300 GISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGK 359
GI FLLGD+EASQGAFQYFGL+E QVPLI+IQTNDGQKYLK NL+ D IAPWVK YKEGK
Sbjct: 301 GIIFLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGK 360
Query: 360 VPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA 419
V +RKSEPIPE NNEPVKV+VAD+LQD+VFNSGKNVLLEFYAPWCGHCK+LAPILDEVA
Sbjct: 361 VQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVA 420
Query: 420 VSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIE 479
VSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK Y+GDRTK+DI+ FIE
Sbjct: 421 VSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIE 480
Query: 480 NNRDKAAPKETVKEESGKDEL 500
NRDKAA +E+ +GKDEL
Sbjct: 481 KNRDKAAQQESA---NGKDEL 498
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|11133775|sp|Q43116.1|PDI_RICCO RecName: Full=Protein disulfide-isomerase; Short=PDI; Flags: Precursor gi|1134968|gb|AAB05641.1| protein disulphide isomerase PDI [Ricinus communis] gi|1587210|prf||2206331A protein disulfide isomerase | Back alignment and taxonomy information |
|---|
| >gi|133902301|gb|ABO41832.1| putative protein disulfide isomerase [Gossypium raimondii] | Back alignment and taxonomy information |
|---|
| >gi|225459587|ref|XP_002285864.1| PREDICTED: protein disulfide-isomerase [Vitis vinifera] gi|302141800|emb|CBI19003.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356518549|ref|XP_003527941.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224063066|ref|XP_002300980.1| predicted protein [Populus trichocarpa] gi|222842706|gb|EEE80253.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351722359|ref|NP_001238009.1| protein disulfide isomerase-like protein precursor [Glycine max] gi|49257109|dbj|BAD24712.1| protein disulfide isomerase-like protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118489117|gb|ABK96365.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|133902323|gb|ABO41851.1| putative protein disulfide isomerase [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|188509919|gb|ACD56608.1| putative protein disulfide [Gossypioides kirkii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 500 | ||||||
| UNIPROTKB|Q43116 | 498 | Q43116 "Protein disulfide-isom | 0.994 | 0.997 | 0.758 | 5.8e-208 | |
| TAIR|locus:2036906 | 501 | PDIL1-1 "AT1G21750" [Arabidops | 0.998 | 0.996 | 0.687 | 1.6e-191 | |
| TAIR|locus:2204670 | 508 | PDIL1-2 "AT1G77510" [Arabidops | 0.934 | 0.919 | 0.697 | 3.2e-184 | |
| UNIPROTKB|Q53LQ0 | 512 | PDIL1-1 "Protein disulfide iso | 0.938 | 0.916 | 0.639 | 6.8e-166 | |
| FB|FBgn0014002 | 496 | Pdi "Protein disulfide isomera | 0.954 | 0.961 | 0.365 | 1.3e-82 | |
| UNIPROTKB|P09102 | 515 | P4HB "Protein disulfide-isomer | 0.952 | 0.924 | 0.363 | 1.2e-79 | |
| UNIPROTKB|P13667 | 645 | PDIA4 "Protein disulfide-isome | 0.89 | 0.689 | 0.386 | 5.4e-79 | |
| WB|WBGene00003964 | 488 | pdi-3 [Caenorhabditis elegans | 0.862 | 0.883 | 0.372 | 6.2e-78 | |
| UNIPROTKB|G5ED07 | 488 | pdi-3 "CeERp57" [Caenorhabditi | 0.862 | 0.883 | 0.372 | 6.2e-78 | |
| UNIPROTKB|F1NDY9 | 627 | PDIA4 "Uncharacterized protein | 0.902 | 0.719 | 0.380 | 2.1e-77 |
| UNIPROTKB|Q43116 Q43116 "Protein disulfide-isomerase" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
Score = 2011 (713.0 bits), Expect = 5.8e-208, P = 5.8e-208
Identities = 380/501 (75%), Positives = 435/501 (86%)
Query: 1 MASSR-SILALVLTIACCMTXXXXXXXXXXKEFVLTLDHSNFSDTVSKHNFIVVEFYAPW 59
MAS R SI + ++ + VLTLD +NF+DT+SKH+FIVVEFYAPW
Sbjct: 1 MASFRGSIWYCIFVLSLIAVAISAAESEEEQSSVLTLDSTNFTDTISKHDFIVVEFYAPW 60
Query: 60 CGHCKKLAPEYEKAASELSSHDPPVVLAKVDANEEANKELASQYEIRGFPTIKILRNGGK 119
CGHCKKL PEYEKAAS L SHD PVVLAKVDANEEANKELA+QY+I+GFPT+KILRNGGK
Sbjct: 61 CGHCKKLRPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGK 120
Query: 120 TIQEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFEN 179
+IQEYKGPREADGI EYLKKQSGPAS EIKS E A++FIG+KK+ I+GVFP FSGEE+EN
Sbjct: 121 SIQEYKGPREADGIAEYLKKQSGPASVEIKSTEAANTFIGDKKIFIVGVFPKFSGEEYEN 180
Query: 180 YTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLFKPFDELFVDFKDFKVDALEKFV 239
Y ++A+KLRSDYEFGHT +AK LP+GESSVTGPVVRLFKPFDELFVDFKDF VDALEKFV
Sbjct: 181 YMSVADKLRSDYEFGHTLDAKHLPQGESSVTGPVVRLFKPFDELFVDFKDFNVDALEKFV 240
Query: 240 EESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQ 299
EESS+P+VTVFNSD +NHPFVIKFFNSP+AKAMLFMNF+ E + I+SKY+EVA Q+KG+
Sbjct: 241 EESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGE 300
Query: 300 GISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGK 359
GI LLGD+EASQGAFQYFGL+E QVPLI+IQTNDGQKYLK NL+ D IAPWVK YKEGK
Sbjct: 301 GIILLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGK 360
Query: 360 VPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA 419
V +RKSEPIPE NNEPVKV+VAD+LQD+VFNSGKNVLLEFYAPWCGHCK+LAPILDEVA
Sbjct: 361 VQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVA 420
Query: 420 VSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIE 479
VSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK Y+GDRTK+DI+ FIE
Sbjct: 421 VSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIE 480
Query: 480 NNRDKAAPKETVKEESGKDEL 500
NRDKAA +E+ +GKDEL
Sbjct: 481 KNRDKAAQQESA---NGKDEL 498
|
|
| TAIR|locus:2036906 PDIL1-1 "AT1G21750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204670 PDIL1-2 "AT1G77510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q53LQ0 PDIL1-1 "Protein disulfide isomerase-like 1-1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0014002 Pdi "Protein disulfide isomerase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09102 P4HB "Protein disulfide-isomerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P13667 PDIA4 "Protein disulfide-isomerase A4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003964 pdi-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5ED07 pdi-3 "CeERp57" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDY9 PDIA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00015407001 | SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (499 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00025969001 | • | • | • | • | 0.483 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 500 | |||
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 1e-167 | |
| PTZ00102 | 477 | PTZ00102, PTZ00102, disulphide isomerase; Provisio | 1e-101 | |
| cd02995 | 104 | cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T | 4e-46 | |
| cd02961 | 101 | cd02961, PDI_a_family, Protein Disulfide Isomerase | 4e-41 | |
| TIGR01126 | 102 | TIGR01126, pdi_dom, protein disulfide-isomerase do | 3e-39 | |
| pfam00085 | 104 | pfam00085, Thioredoxin, Thioredoxin | 3e-37 | |
| TIGR01126 | 102 | TIGR01126, pdi_dom, protein disulfide-isomerase do | 2e-36 | |
| cd02998 | 105 | cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret | 8e-34 | |
| cd02961 | 101 | cd02961, PDI_a_family, Protein Disulfide Isomerase | 7e-33 | |
| cd02998 | 105 | cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret | 2e-32 | |
| pfam00085 | 104 | pfam00085, Thioredoxin, Thioredoxin | 8e-32 | |
| cd03001 | 103 | cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp | 2e-31 | |
| cd03002 | 109 | cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su | 4e-31 | |
| cd02997 | 104 | cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; | 1e-30 | |
| cd03005 | 102 | cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret | 1e-26 | |
| cd03000 | 104 | cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; | 3e-25 | |
| cd02995 | 104 | cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T | 3e-23 | |
| pfam13848 | 183 | pfam13848, Thioredoxin_6, Thioredoxin-like domain | 1e-22 | |
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 7e-22 | |
| cd02947 | 93 | cd02947, TRX_family, TRX family; composed of two g | 4e-21 | |
| cd03001 | 103 | cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp | 6e-21 | |
| cd03000 | 104 | cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; | 3e-20 | |
| cd03004 | 104 | cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER | 4e-20 | |
| cd03005 | 102 | cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret | 6e-20 | |
| cd02992 | 114 | cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd | 3e-18 | |
| cd02996 | 108 | cd02996, PDI_a_ERp44, PDIa family, endoplasmic ret | 4e-18 | |
| cd02997 | 104 | cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; | 8e-18 | |
| cd02982 | 103 | cd02982, PDI_b'_family, Protein Disulfide Isomeras | 8e-18 | |
| cd02981 | 97 | cd02981, PDI_b_family, Protein Disulfide Isomerase | 1e-17 | |
| TIGR01068 | 101 | TIGR01068, thioredoxin, thioredoxin | 3e-17 | |
| TIGR01068 | 101 | TIGR01068, thioredoxin, thioredoxin | 1e-14 | |
| PTZ00443 | 224 | PTZ00443, PTZ00443, Thioredoxin domain-containing | 2e-14 | |
| cd03002 | 109 | cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su | 7e-14 | |
| cd02947 | 93 | cd02947, TRX_family, TRX family; composed of two g | 3e-13 | |
| PTZ00051 | 98 | PTZ00051, PTZ00051, thioredoxin; Provisional | 4e-13 | |
| PRK10996 | 139 | PRK10996, PRK10996, thioredoxin 2; Provisional | 5e-13 | |
| COG3118 | 304 | COG3118, COG3118, Thioredoxin domain-containing pr | 8e-13 | |
| cd02994 | 101 | cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co | 1e-12 | |
| PTZ00443 | 224 | PTZ00443, PTZ00443, Thioredoxin domain-containing | 4e-12 | |
| cd02996 | 108 | cd02996, PDI_a_ERp44, PDIa family, endoplasmic ret | 1e-11 | |
| cd02994 | 101 | cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co | 2e-11 | |
| cd03004 | 104 | cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER | 4e-11 | |
| cd02956 | 96 | cd02956, ybbN, ybbN protein family; ybbN is a hypo | 5e-11 | |
| COG0526 | 127 | COG0526, TrxA, Thiol-disulfide isomerase and thior | 2e-10 | |
| cd02992 | 114 | cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd | 3e-10 | |
| cd02999 | 100 | cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi | 6e-10 | |
| PRK09381 | 109 | PRK09381, trxA, thioredoxin; Provisional | 6e-10 | |
| pfam13098 | 105 | pfam13098, Thioredoxin_2, Thioredoxin-like domain | 3e-09 | |
| PRK09381 | 109 | PRK09381, trxA, thioredoxin; Provisional | 2e-08 | |
| pfam13098 | 105 | pfam13098, Thioredoxin_2, Thioredoxin-like domain | 2e-08 | |
| cd03003 | 101 | cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER | 3e-08 | |
| cd02993 | 109 | cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden | 3e-08 | |
| cd01659 | 69 | cd01659, TRX_superfamily, Thioredoxin (TRX) superf | 3e-08 | |
| cd03003 | 101 | cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER | 4e-08 | |
| COG0526 | 127 | COG0526, TrxA, Thiol-disulfide isomerase and thior | 7e-08 | |
| cd02966 | 116 | cd02966, TlpA_like_family, TlpA-like family; compo | 2e-07 | |
| cd02950 | 142 | cd02950, TxlA, TRX-like protein A (TxlA) family; T | 2e-07 | |
| cd02993 | 109 | cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden | 4e-07 | |
| cd03011 | 123 | cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, | 6e-07 | |
| cd01659 | 69 | cd01659, TRX_superfamily, Thioredoxin (TRX) superf | 8e-07 | |
| cd03069 | 104 | cd03069, PDI_b_ERp57, PDIb family, ERp57 subfamily | 8e-07 | |
| COG3118 | 304 | COG3118, COG3118, Thioredoxin domain-containing pr | 1e-06 | |
| cd02956 | 96 | cd02956, ybbN, ybbN protein family; ybbN is a hypo | 1e-06 | |
| cd03011 | 123 | cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, | 2e-06 | |
| cd02984 | 97 | cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int | 2e-06 | |
| pfam13899 | 81 | pfam13899, Thioredoxin_7, Thioredoxin-like | 1e-05 | |
| PLN02309 | 457 | PLN02309, PLN02309, 5'-adenylylsulfate reductase | 2e-05 | |
| cd02966 | 116 | cd02966, TlpA_like_family, TlpA-like family; compo | 4e-05 | |
| pfam13905 | 94 | pfam13905, Thioredoxin_8, Thioredoxin-like | 4e-05 | |
| cd02999 | 100 | cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi | 6e-05 | |
| COG4232 | 569 | COG4232, COG4232, Thiol:disulfide interchange prot | 9e-05 | |
| cd02953 | 104 | cd02953, DsbDgamma, DsbD gamma family; DsbD gamma | 9e-05 | |
| PRK10996 | 139 | PRK10996, PRK10996, thioredoxin 2; Provisional | 2e-04 | |
| COG4232 | 569 | COG4232, COG4232, Thiol:disulfide interchange prot | 3e-04 | |
| cd03006 | 113 | cd03006, PDI_a_EFP1_N, PDIa family, N-terminal EFP | 3e-04 | |
| PTZ00051 | 98 | PTZ00051, PTZ00051, thioredoxin; Provisional | 4e-04 | |
| cd02976 | 73 | cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is | 5e-04 | |
| pfam13905 | 94 | pfam13905, Thioredoxin_8, Thioredoxin-like | 6e-04 | |
| cd02949 | 97 | cd02949, TRX_NTR, TRX domain, novel NADPH thioredo | 7e-04 | |
| PRK00293 | 571 | PRK00293, dipZ, thiol:disulfide interchange protei | 7e-04 | |
| PRK00293 | 571 | PRK00293, dipZ, thiol:disulfide interchange protei | 8e-04 | |
| cd02950 | 142 | cd02950, TxlA, TRX-like protein A (TxlA) family; T | 0.001 | |
| PLN02309 | 457 | PLN02309, PLN02309, 5'-adenylylsulfate reductase | 0.002 | |
| cd02953 | 104 | cd02953, DsbDgamma, DsbD gamma family; DsbD gamma | 0.002 | |
| TIGR00385 | 173 | TIGR00385, dsbE, periplasmic protein thiol:disulfi | 0.002 | |
| cd02984 | 97 | cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int | 0.003 | |
| cd03020 | 197 | cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and Dsb | 0.003 | |
| TIGR00424 | 463 | TIGR00424, APS_reduc, 5'-adenylylsulfate reductase | 0.003 | |
| cd03068 | 107 | cd03068, PDI_b_ERp72, PDIb family, ERp72 subfamily | 0.003 |
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
Score = 480 bits (1238), Expect = e-167
Identities = 196/461 (42%), Positives = 284/461 (61%), Gaps = 18/461 (3%)
Query: 31 EFVLTLDHSNFSDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASELSSHDPPVVLAKVD 90
E VL L NF D + H F++VEFYAPWCGHCK LAPEYEKAA EL PP+ LAKVD
Sbjct: 1 EDVLVLTKDNFDDFIKSHEFVLVEFYAPWCGHCKSLAPEYEKAADELKKKGPPIKLAKVD 60
Query: 91 ANEEANKELASQYEIRGFPTIKILRNGGKTIQEYKGPREADGIVEYLKKQSGPASAEIKS 150
A EE K+LA +Y + G+PT+KI RNG ++ +Y GPR+ADGIV+Y+KKQSGPA EI++
Sbjct: 61 ATEE--KDLAQKYGVSGYPTLKIFRNGEDSVSDYNGPRDADGIVKYMKKQSGPAVKEIET 118
Query: 151 AEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYE-FGHTQNAKLLPRGESSV 209
D +F+ + VV+IG F + E + + ++AEKLR Y F H+ + + +
Sbjct: 119 VADLEAFLADDDVVVIGFFKDLDSELNDTFLSVAEKLRDVYFFFAHSSDVAAFAKLGAFP 178
Query: 210 TGPVVRLFKPFDE---LFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNS 266
V+ K DE D V LEKF+ S+P+V F + F +
Sbjct: 179 DSVVLFKPKDEDEKFSKVDGEMDTDVSDLEKFIRAESLPLVGEFTQETAAKYFE----SG 234
Query: 267 PNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVP 326
P ++ S + E +++++ E A++++G+ ++F + D E +YFGL+ + P
Sbjct: 235 PLVVLYYNVDESLDPFEELRNRFLEAAKKFRGKFVNFAVADEEDFGRELEYFGLKAEKFP 294
Query: 327 LIVIQTNDG-QKYLKPN--LDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVAD 383
+ IQ +G +KY ++ + +VK++ +GK+ P+ KSEPIPE++ PVKVLV
Sbjct: 295 AVAIQDLEGNKKYPMDQEEFSSENLEAFVKDFLDGKLKPYLKSEPIPEDDEGPVKVLVGK 354
Query: 384 SLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQN-DADVVIAKFDATANDIPG 442
+ ++V + K+VL+EFYAPWCGHCK LAPI +E+A Y++ ++DVVIAK DATAND+P
Sbjct: 355 NFDEIVLDETKDVLVEFYAPWCGHCKNLAPIYEELAEKYKDAESDVVIAKMDATANDVPP 414
Query: 443 DTFEVQGYPTVFFRSASGKT--VPYEGDRTKEDIVDFIENN 481
FEV+G+PT+ F A K+ VPY+GDRT ED FI +
Sbjct: 415 --FEVEGFPTIKFVPAGKKSEPVPYDGDRTLEDFSKFIAKH 453
|
This model represents eukaryotic protein disulfide isomerases retained in the endoplasmic reticulum (ER) and closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). Length = 462 |
| >gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >gnl|CDD|239294 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >gnl|CDD|239280 cd02982, PDI_b'_family, Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|239279 cd02981, PDI_b_family, Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239294 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239248 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >gnl|CDD|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >gnl|CDD|239309 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >gnl|CDD|239367 cd03069, PDI_b_ERp57, PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239309 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >gnl|CDD|226685 COG4232, COG4232, Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226685 COG4232, COG4232, Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239304 cd03006, PDI_a_EFP1_N, PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|239247 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >gnl|CDD|234717 PRK00293, dipZ, thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234717 PRK00293, dipZ, thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239248 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >gnl|CDD|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >gnl|CDD|129481 TIGR00385, dsbE, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >gnl|CDD|239318 cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >gnl|CDD|232970 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >gnl|CDD|239366 cd03068, PDI_b_ERp72, PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 100.0 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 100.0 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 100.0 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 100.0 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 100.0 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.92 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 99.87 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.86 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.84 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.83 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.82 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.81 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.81 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.8 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.79 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.79 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.78 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.78 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.77 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.77 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.76 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.76 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.76 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.76 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.76 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.75 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.74 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.74 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.73 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.73 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.73 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.72 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.72 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.72 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.72 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.72 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.72 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.72 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.72 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.72 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.72 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.71 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.71 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 99.71 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.71 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.71 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.7 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.69 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.69 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.69 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.68 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.68 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.68 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.68 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.68 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.68 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.67 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.67 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.66 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.66 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.66 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.66 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.66 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.66 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.66 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.65 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.65 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.65 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.65 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 99.64 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.64 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.64 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 99.62 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.62 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.62 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.62 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.61 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.59 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.59 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.59 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.58 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.58 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.58 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 99.58 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 99.57 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.57 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.57 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 99.57 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.57 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.56 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.56 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 99.55 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.55 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.55 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 99.55 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.54 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 99.54 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.53 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.52 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.51 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.51 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.51 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.5 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.5 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 99.49 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 99.49 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 99.46 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 99.46 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.45 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.45 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 99.45 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 99.45 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 99.44 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.44 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 99.41 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.4 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.4 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 99.39 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 99.38 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.37 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.36 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.36 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 99.35 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 99.34 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 99.31 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.31 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 99.31 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 99.3 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 99.29 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 99.29 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.28 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.28 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 99.28 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 99.27 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.26 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 99.25 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 99.24 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.23 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 99.22 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 99.21 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 99.18 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 99.16 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 99.15 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 99.15 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 99.14 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 99.13 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 99.12 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 99.08 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 99.07 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 99.07 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 99.06 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 99.06 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 99.06 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 99.05 | |
| PHA02125 | 75 | thioredoxin-like protein | 99.05 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 99.03 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 99.03 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 99.02 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 99.01 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 99.0 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 99.0 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 98.98 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 98.98 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 98.96 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 98.95 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 98.94 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.93 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 98.93 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 98.93 | |
| PHA02125 | 75 | thioredoxin-like protein | 98.93 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 98.92 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 98.91 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 98.9 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 98.9 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 98.89 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 98.89 | |
| smart00594 | 122 | UAS UAS domain. | 98.89 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 98.88 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 98.86 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 98.86 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 98.85 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.85 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 98.83 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 98.83 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.82 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 98.82 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 98.82 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 98.82 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 98.79 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 98.79 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.79 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 98.79 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 98.78 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 98.77 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 98.76 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.76 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 98.75 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 98.73 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 98.72 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 98.71 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 98.71 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 98.69 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 98.67 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.65 | |
| PLN02412 | 167 | probable glutathione peroxidase | 98.65 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 98.65 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 98.64 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 98.64 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.62 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 98.6 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 98.58 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 98.53 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 98.5 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 98.49 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 98.44 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 98.44 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 98.42 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 98.41 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 98.4 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 98.4 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 98.39 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 98.39 | |
| smart00594 | 122 | UAS UAS domain. | 98.38 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 98.37 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.34 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.32 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 98.29 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 98.28 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 98.27 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 98.27 | |
| PLN02412 | 167 | probable glutathione peroxidase | 98.26 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 98.24 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 98.24 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 98.24 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 98.22 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 98.17 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 98.15 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.15 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 98.14 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 98.14 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 98.14 | |
| cd03070 | 91 | PDI_b_ERp44 PDIb family, ERp44 subfamily, first re | 98.14 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 98.11 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 98.09 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 98.09 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 98.09 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.08 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 98.07 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 98.02 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 98.01 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 98.01 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.01 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 97.99 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 97.99 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 97.98 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 97.98 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 97.97 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 97.97 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 97.95 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 97.94 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 97.94 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 97.93 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 97.93 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 97.92 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 97.92 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 97.91 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 97.91 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 97.9 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 97.9 | |
| PRK15000 | 200 | peroxidase; Provisional | 97.89 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 97.86 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 97.85 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 97.84 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 97.83 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 97.83 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 97.82 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 97.82 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 97.78 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 97.76 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 97.75 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 97.75 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 97.72 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 97.72 | |
| cd03071 | 116 | PDI_b'_NRX PDIb' family, NRX subgroup, redox inact | 97.71 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 97.7 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 97.69 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 97.68 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 97.67 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 97.67 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 97.66 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 97.66 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 97.58 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 97.56 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 97.55 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 97.55 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 97.53 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 97.52 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 97.51 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 97.5 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 97.48 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 97.44 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 97.43 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 97.42 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 97.41 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 97.35 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 97.34 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 97.29 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 97.27 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 97.23 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 97.19 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 97.17 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 97.13 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 97.12 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 97.11 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 97.09 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 97.09 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 97.08 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.07 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 97.06 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 97.05 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 97.04 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 97.03 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 97.02 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 97.01 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 96.96 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 96.96 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 96.93 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 96.91 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 96.9 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 96.89 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 96.87 | |
| KOG3170 | 240 | consensus Conserved phosducin-like protein [Signal | 96.84 | |
| PRK15000 | 200 | peroxidase; Provisional | 96.79 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 96.78 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 96.75 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 96.75 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 96.63 | |
| KOG3171 | 273 | consensus Conserved phosducin-like protein [Signal | 96.62 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 96.61 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 96.57 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 96.56 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 96.54 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 96.52 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 96.51 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 96.51 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 96.49 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 96.49 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 96.49 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 96.48 | |
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 96.41 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 96.39 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 96.37 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 96.31 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 96.28 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 96.25 | |
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 96.24 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 96.19 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 96.1 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 96.09 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 96.08 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 96.06 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 96.05 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 96.03 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 96.03 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 96.02 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 95.99 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 95.99 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 95.93 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 95.91 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 95.91 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 95.89 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 95.87 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 95.73 | |
| PF00837 | 237 | T4_deiodinase: Iodothyronine deiodinase; InterPro: | 95.68 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 95.64 | |
| COG1999 | 207 | Uncharacterized protein SCO1/SenC/PrrC, involved i | 95.63 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 95.63 | |
| COG1225 | 157 | Bcp Peroxiredoxin [Posttranslational modification, | 95.52 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 95.47 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 95.44 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 95.36 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 95.3 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 95.28 | |
| PF13743 | 176 | Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. | 95.23 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 95.04 | |
| PF02630 | 174 | SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam | 95.01 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 95.01 | |
| KOG2640 | 319 | consensus Thioredoxin [Function unknown] | 94.91 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 94.88 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 94.79 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 94.71 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 94.58 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 94.53 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 94.23 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 93.79 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 93.7 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 93.5 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 93.46 | |
| KOG3171 | 273 | consensus Conserved phosducin-like protein [Signal | 93.01 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 92.77 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 92.73 | |
| cd02974 | 94 | AhpF_NTD_N Alkyl hydroperoxide reductase F subunit | 92.1 | |
| KOG2640 | 319 | consensus Thioredoxin [Function unknown] | 91.87 | |
| KOG3170 | 240 | consensus Conserved phosducin-like protein [Signal | 91.75 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 91.68 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 91.43 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 91.12 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 90.51 | |
| cd03013 | 155 | PRX5_like Peroxiredoxin (PRX) family, PRX5-like su | 90.47 | |
| KOG2507 | 506 | consensus Ubiquitin regulatory protein UBXD2, cont | 90.47 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 88.59 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 88.07 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 86.66 | |
| KOG2792 | 280 | consensus Putative cytochrome C oxidase assembly p | 86.41 | |
| cd02990 | 136 | UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 | 86.16 | |
| PF01323 | 193 | DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 | 86.07 | |
| COG1331 | 667 | Highly conserved protein containing a thioredoxin | 86.06 | |
| COG1651 | 244 | DsbG Protein-disulfide isomerase [Posttranslationa | 85.29 | |
| cd02978 | 72 | KaiB_like KaiB-like family; composed of the circad | 84.68 | |
| TIGR02654 | 87 | circ_KaiB circadian clock protein KaiB. Members of | 84.24 | |
| PF00837 | 237 | T4_deiodinase: Iodothyronine deiodinase; InterPro: | 83.52 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 83.43 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 83.39 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 83.26 | |
| cd02974 | 94 | AhpF_NTD_N Alkyl hydroperoxide reductase F subunit | 83.24 | |
| PRK09301 | 103 | circadian clock protein KaiB; Provisional | 82.39 | |
| PF06053 | 249 | DUF929: Domain of unknown function (DUF929); Inter | 82.37 | |
| PHA03075 | 123 | glutaredoxin-like protein; Provisional | 81.84 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 81.28 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 81.12 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 80.92 |
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-70 Score=520.90 Aligned_cols=459 Identities=49% Similarity=0.869 Sum_probs=410.6
Q ss_pred cccCceEEcCccChhhhhccCCeEEEEEECCCChhhhhhhHHHHHHHHHhcCCCCCeEEEEEecChhhhHHHHHhcCccc
Q 010804 28 ESKEFVLTLDHSNFSDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASELSSHDPPVVLAKVDANEEANKELASQYEIRG 107 (500)
Q Consensus 28 ~~~~~v~~l~~~~~~~~~~~~~~~lv~f~~~~c~~C~~~~~~~~~~~~~~~~~~~~v~~~~vd~~~~~~~~~~~~~~i~~ 107 (500)
...+.|+.|+..||+..+..+..++|.||||||+||+++.|.|+++|+.+++.++.+..+.|||+.+.. +|.+|+|++
T Consensus 22 ~~~~~Vl~Lt~dnf~~~i~~~~~vlVeFYAPWCghck~LaPey~kAA~~Lke~~s~i~LakVDat~~~~--~~~~y~v~g 99 (493)
T KOG0190|consen 22 KAEEDVLVLTKDNFKETINGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDATEESD--LASKYEVRG 99 (493)
T ss_pred CcccceEEEecccHHHHhccCceEEEEEEchhhhhhhhhCcHHHHHHHHhhccCCCceeEEeecchhhh--hHhhhcCCC
Confidence 346789999999999999999999999999999999999999999999999988899999999999977 999999999
Q ss_pred ccEEEEEecCCceeeecCCCCCHHHHHHHHHhhcCCCccccCChhhHhhhhccCCeEEEEEecCCCchhHHHHHHHHHHh
Q 010804 108 FPTIKILRNGGKTIQEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKL 187 (500)
Q Consensus 108 ~P~~~~~~~~~~~~~~~~g~~~~~~l~~~i~~~~~~~~~~i~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~f~~~a~~~ 187 (500)
|||+.+|++|.. ...|.|.++.++|+.|+.+..+|.+..+.+.+++..++..++.++|++|.+..+.. ..|...|..+
T Consensus 100 yPTlkiFrnG~~-~~~Y~G~r~adgIv~wl~kq~gPa~~~l~~~~~a~~~l~~~~~~vig~F~d~~~~~-~~~~~~a~~l 177 (493)
T KOG0190|consen 100 YPTLKIFRNGRS-AQDYNGPREADGIVKWLKKQSGPASKTLKTVDEAEEFLSKKDVVVIGFFKDLESLA-ESFFDAASKL 177 (493)
T ss_pred CCeEEEEecCCc-ceeccCcccHHHHHHHHHhccCCCceecccHHHHHhhccCCceEEEEEecccccch-HHHHHHHHhc
Confidence 999999999843 78999999999999999999999999999999999999999999999999887777 9999999999
Q ss_pred cCCceEEEeecccccCCCCCCCCCC---eEEEeccCCCcc-cccCCCCHHHHHHHHHHccCCcEEEeCCCCCCccchhhh
Q 010804 188 RSDYEFGHTQNAKLLPRGESSVTGP---VVRLFKPFDELF-VDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKF 263 (500)
Q Consensus 188 ~~~~~f~~~~~~~~~~~~~~~~~~p---~~~~~~~~~~~~-~~~~~~~~~~l~~~i~~~~~p~~~~~~~~~~~~~~~~~~ 263 (500)
++++.|+++.+.+++++ +..+.+ .+++++..|+.. .|.|+++.+.|..||..+++|++..+|. .+...+
T Consensus 178 ~~d~~F~~ts~~~~~~~--~~~~~~~~~~i~l~kk~d~~~~~~~~~~~~~~l~~Fi~~~~~plv~~ft~-----~~~~~~ 250 (493)
T KOG0190|consen 178 RDDYKFAHTSDSDVAKK--LELNTEGTFPIVLFKKFDELLVKYDGSFTPELLKKFIQENSLPLVTEFTV-----ANNAKI 250 (493)
T ss_pred cccceeeccCcHhHHhh--ccCCCCCcceEEeccccccchhhcccccCHHHHHHHHHHhcccccceecc-----ccccee
Confidence 99999999999999999 666544 488999988888 6789999999999999999999999999 577777
Q ss_pred hcCCCceEE-EEEeCCCCCchHHHHHHHHHHHhhcCceeEEEEEcccchhhHHhhcCCCCCCCc-eEEEEeCCCCcc-CC
Q 010804 264 FNSPNAKAM-LFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVP-LIVIQTNDGQKY-LK 340 (500)
Q Consensus 264 ~~~~~~~~~-l~~~~~~~~~~~~~~~l~~va~~~~~~~~~f~~~d~~~~~~~~~~~gi~~~~~P-~i~i~~~~~~~y-~~ 340 (500)
+.+..+..+ ++.+..+...+.+++.++++|++|+++ ++|+++|...++..++.||+.....| .+++.+....+| +.
T Consensus 251 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~vAk~f~~~-l~Fi~~d~e~~~~~~~~~Gl~~~~~~~~~v~~~~~~~Ky~~~ 329 (493)
T KOG0190|consen 251 YSSFVKLGLDFFVFFKCNRFEELRKKFEEVAKKFKGK-LRFILIDPESFARVLEFFGLEEEQLPIRAVILNEDGSKYPLE 329 (493)
T ss_pred eccccccceeEEeccccccHHHHHHHHHHHHHhcccc-eEEEEEChHHhhHHHHhcCcccccCCeeEEeeccccccccCc
Confidence 777655544 555556667899999999999999999 99999999999999999999977777 555555555888 66
Q ss_pred -CCCChhhHHHHHHHHhcCCCCCccccCCCCCCCC-CCeEEEeccchhhhhhcCCCeEEEEEECCCChhHhhhhHHHHHH
Q 010804 341 -PNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENN-EPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEV 418 (500)
Q Consensus 341 -~~~~~~~i~~fi~~~~~G~l~~~~~s~~~~~~~~-~~~~~l~~~~~~~~~~~~~~~~~v~f~~~~c~~c~~~~~~~~~~ 418 (500)
.+.+.++|+.|+.++++|+++|++||+++|+.+. ++|+.+.+++|++++.+.+|+|+|-||||||+||+.+.|.|+++
T Consensus 330 ~e~~~~~~ie~f~~~~l~Gk~~p~~kSqpiPe~~~~~pVkvvVgknfd~iv~de~KdVLvEfyAPWCgHCk~laP~~eeL 409 (493)
T KOG0190|consen 330 EEELDQENIESFVKDFLDGKVKPHLKSQPIPEDNDRSPVKVVVGKNFDDIVLDEGKDVLVEFYAPWCGHCKALAPIYEEL 409 (493)
T ss_pred cccccHHHHHHHHHHHhcCccccccccCCCCcccccCCeEEEeecCHHHHhhccccceEEEEcCcccchhhhhhhHHHHH
Confidence 5599999999999999999999999999999665 88999999999999999999999999999999999999999999
Q ss_pred HHHcCCCCceEEEEEeCCCCCCCCCCCCcCcceEEEEEcCCCc--eEEecCCCCHHHHHHHHHhhcCCCCC--CCCCccc
Q 010804 419 AVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGK--TVPYEGDRTKEDIVDFIENNRDKAAP--KETVKEE 494 (500)
Q Consensus 419 ~~~~~~~~~~~~~~id~~~~~~~~~~~~i~~~P~~~~~~~~~~--~~~~~g~~~~~~l~~~i~~~~~~~~~--~~~~~~~ 494 (500)
+..+++..++.+++||.+.|+.+.. .+.++|||++|+.|++ ++.|.|.++.+++..||.++...... .+.....
T Consensus 410 Ae~~~~~~~vviAKmDaTaNd~~~~--~~~~fPTI~~~pag~k~~pv~y~g~R~le~~~~fi~~~a~~~~~~~~ee~~~~ 487 (493)
T KOG0190|consen 410 AEKYKDDENVVIAKMDATANDVPSL--KVDGFPTILFFPAGHKSNPVIYNGDRTLEDLKKFIKKSATESATPKKEEKKDE 487 (493)
T ss_pred HHHhcCCCCcEEEEeccccccCccc--cccccceEEEecCCCCCCCcccCCCcchHHHHhhhccCCCccccccchhcccc
Confidence 9999988899999999999999984 6777999999999974 88999999999999999998862211 1111222
Q ss_pred cCCCCC
Q 010804 495 SGKDEL 500 (500)
Q Consensus 495 ~~~~e~ 500 (500)
+.+|||
T Consensus 488 ~~~dEL 493 (493)
T KOG0190|consen 488 SVKDEL 493 (493)
T ss_pred cccccC
Confidence 567776
|
|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >cd03070 PDI_b_ERp44 PDIb family, ERp44 subfamily, first redox inactive TRX-like domain b; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2640 consensus Thioredoxin [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >KOG2640 consensus Thioredoxin [Function unknown] | Back alignment and domain information |
|---|
| >KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol | Back alignment and domain information |
|---|
| >KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain | Back alignment and domain information |
|---|
| >PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] | Back alignment and domain information |
|---|
| >COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA | Back alignment and domain information |
|---|
| >TIGR02654 circ_KaiB circadian clock protein KaiB | Back alignment and domain information |
|---|
| >PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PRK09301 circadian clock protein KaiB; Provisional | Back alignment and domain information |
|---|
| >PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function | Back alignment and domain information |
|---|
| >PHA03075 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 500 | ||||
| 3f8u_A | 481 | TapasinERP57 HETERODIMER Length = 481 | 6e-73 | ||
| 2b5e_A | 504 | Crystal Structure Of Yeast Protein Disulfide Isomer | 1e-48 | ||
| 3uem_A | 361 | Crystal Structure Of Human Pdi Bb'a' Domains Length | 1e-38 | ||
| 1mek_A | 120 | Human Protein Disulfide Isomerase, Nmr, 40 Structur | 3e-31 | ||
| 1mek_A | 120 | Human Protein Disulfide Isomerase, Nmr, 40 Structur | 7e-12 | ||
| 3idv_A | 241 | Crystal Structure Of The A0a Fragment Of Erp72 Leng | 2e-30 | ||
| 3idv_A | 241 | Crystal Structure Of The A0a Fragment Of Erp72 Leng | 3e-15 | ||
| 2dj2_A | 120 | The Solution Structure Of The Second Thioredoxin Do | 3e-30 | ||
| 2dj2_A | 120 | The Solution Structure Of The Second Thioredoxin Do | 1e-13 | ||
| 2dmm_A | 142 | The Solution Structure Of The Second Thioredoxin Do | 3e-29 | ||
| 2alb_A | 113 | Nmr Structure Of The N-Terminal Domain A Of The Gly | 5e-25 | ||
| 2alb_A | 113 | Nmr Structure Of The N-Terminal Domain A Of The Gly | 2e-11 | ||
| 2dj3_A | 133 | The Solution Structure Of The Third Thioredoxin Dom | 8e-24 | ||
| 2djj_A | 121 | Solution Structure Of The A' Domain Of Thermophilic | 2e-23 | ||
| 2dj1_A | 140 | The Solution Structure Of The First Thioredoxin Dom | 4e-23 | ||
| 2dj1_A | 140 | The Solution Structure Of The First Thioredoxin Dom | 5e-16 | ||
| 1x5c_A | 121 | The Solution Structure Of The Second Thioredoxin-Li | 3e-22 | ||
| 3uvt_A | 111 | Crystal Structure Of The Third Catalytic Domain Of | 1e-17 | ||
| 3uvt_A | 111 | Crystal Structure Of The Third Catalytic Domain Of | 2e-09 | ||
| 2diz_A | 117 | The Solution Structure Of The Third Thioredoxin Dom | 2e-17 | ||
| 2diz_A | 117 | The Solution Structure Of The Third Thioredoxin Dom | 2e-09 | ||
| 3uj1_A | 110 | Crystal Structure Of The Third Thioredoxin Domain O | 2e-17 | ||
| 3uj1_A | 110 | Crystal Structure Of The Third Thioredoxin Domain O | 2e-09 | ||
| 2dml_A | 130 | The Solution Structure Of The First Thioredoxin Dom | 1e-16 | ||
| 2dml_A | 130 | The Solution Structure Of The First Thioredoxin Dom | 1e-10 | ||
| 1x5d_A | 133 | The Solution Structure Of The Second Thioredoxin-Li | 4e-16 | ||
| 1x5d_A | 133 | The Solution Structure Of The Second Thioredoxin-Li | 4e-13 | ||
| 2r2j_A | 382 | Crystal Structure Of Human Erp44 Length = 382 | 5e-16 | ||
| 2r2j_A | 382 | Crystal Structure Of Human Erp44 Length = 382 | 6e-07 | ||
| 3ed3_A | 298 | Crystal Structure Of The Yeast DithiolDISULFIDE Oxi | 7e-13 | ||
| 3ed3_A | 298 | Crystal Structure Of The Yeast DithiolDISULFIDE Oxi | 9e-09 | ||
| 2h8l_A | 252 | Crystal Structure Of The Bb' Fragment Of Erp57 Leng | 9e-12 | ||
| 2ppt_A | 155 | Crystal Structure Of Thioredoxin-2 Length = 155 | 2e-10 | ||
| 2ppt_A | 155 | Crystal Structure Of Thioredoxin-2 Length = 155 | 2e-05 | ||
| 1uvz_A | 119 | Structure Of Human Thioredoxin 2 Length = 119 | 4e-10 | ||
| 1uvz_A | 119 | Structure Of Human Thioredoxin 2 Length = 119 | 2e-05 | ||
| 2fd3_A | 108 | Crystal Structure Of Thioredoxin Mutant P34h Length | 6e-10 | ||
| 3q6o_A | 244 | Oxidoreductase Fragment Of Human Qsox1 Length = 244 | 1e-09 | ||
| 3q6o_A | 244 | Oxidoreductase Fragment Of Human Qsox1 Length = 244 | 4e-08 | ||
| 3dxb_A | 222 | Structure Of The Uhm Domain Of Puf60 Fused To Thior | 2e-09 | ||
| 3hhv_A | 110 | The Crystal Structure Of The Thioredoxin A2 From Su | 2e-09 | ||
| 3hhv_A | 110 | The Crystal Structure Of The Thioredoxin A2 From Su | 6e-04 | ||
| 2vim_A | 104 | X-Ray Structure Of Fasciola Hepatica Thioredoxin Le | 2e-09 | ||
| 2vim_A | 104 | X-Ray Structure Of Fasciola Hepatica Thioredoxin Le | 2e-04 | ||
| 1x5e_A | 126 | The Solution Structure Of The Thioredoxin-Like Doma | 5e-09 | ||
| 1syr_A | 112 | Initial Structural Analysis Of Plasmodium Falciparu | 6e-09 | ||
| 1syr_A | 112 | Initial Structural Analysis Of Plasmodium Falciparu | 6e-04 | ||
| 1nsw_A | 105 | The Crystal Structure Of The K18g Mutant Of The Thi | 6e-09 | ||
| 1nsw_A | 105 | The Crystal Structure Of The K18g Mutant Of The Thi | 1e-04 | ||
| 3t58_A | 519 | C76aC455S MUTANT OF MOUSE QSOX1 CONTAINING AN INTER | 6e-09 | ||
| 1quw_A | 105 | Solution Structure Of The Thioredoxin From Bacillus | 7e-09 | ||
| 1quw_A | 105 | Solution Structure Of The Thioredoxin From Bacillus | 6e-05 | ||
| 2h75_A | 108 | Crystal Structure Of Thioredoxin Mutant D13e In Hex | 7e-09 | ||
| 2h72_A | 108 | Crystal Structure Of Thioredoxin Mutant E85d In Hex | 8e-09 | ||
| 2h74_A | 108 | Crystal Structure Of Thioredoxin Mutant D2e In Hexa | 9e-09 | ||
| 2h70_A | 108 | Crystal Structure Of Thioredoxin Mutant D9e In Hexa | 1e-08 | ||
| 2cvk_A | 110 | Crystal Structure Of Thermus Thermophilus Thioredox | 1e-08 | ||
| 2cvk_A | 110 | Crystal Structure Of Thermus Thermophilus Thioredox | 2e-06 | ||
| 2yzu_A | 109 | Crystal Structure Of Oxidized Thioredoxin From Ther | 1e-08 | ||
| 2yzu_A | 109 | Crystal Structure Of Oxidized Thioredoxin From Ther | 2e-06 | ||
| 2h71_A | 108 | Crystal Structure Of Thioredoxin Mutant D47e In Hex | 1e-08 | ||
| 2h6y_A | 108 | Crystal Structure Of Thioredoxin Mutant E48d In Hex | 1e-08 | ||
| 1xob_A | 108 | Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur | 1e-08 | ||
| 2trx_A | 108 | Crystal Structure Of Thioredoxin From Escherichia C | 1e-08 | ||
| 1rqm_A | 105 | Solution Structure Of The K18gR82E ALICYCLOBACILLUS | 1e-08 | ||
| 1rqm_A | 105 | Solution Structure Of The K18gR82E ALICYCLOBACILLUS | 1e-04 | ||
| 3dyr_A | 111 | Crystal Structure Of E. Coli Thioredoxin Mutant I76 | 1e-08 | ||
| 1nw2_A | 105 | The Crystal Structure Of The Mutant R82e Of Thiored | 1e-08 | ||
| 1nw2_A | 105 | The Crystal Structure Of The Mutant R82e Of Thiored | 8e-05 | ||
| 2k18_A | 228 | Solution Structure Of Bb' Domains Of Human Protein | 2e-08 | ||
| 2eiq_A | 108 | Design Of Disulfide-linked Thioredoxin Dimers And M | 2e-08 | ||
| 1faa_A | 124 | Crystal Structure Of Thioredoxin F From Spinach Chl | 2e-08 | ||
| 2e0q_A | 104 | Crystal Structure Of K53e Thioredoxin From Sulfolob | 2e-08 | ||
| 1f9m_A | 112 | Crystal Structure Of Thioredoxin F From Spinach Chl | 2e-08 | ||
| 2i1u_A | 121 | Mycobacterium Tuberculosis Thioredoxin C Length = 1 | 2e-08 | ||
| 2eir_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 2e-08 | ||
| 1zzy_A | 108 | Crystal Structure Of Thioredoxin Mutant L7v Length | 2e-08 | ||
| 2eio_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 3e-08 | ||
| 2l4q_A | 116 | Solution Structures Of Oxidized And Reduced Thiored | 3e-08 | ||
| 2h6z_A | 108 | Crystal Structure Of Thioredoxin Mutant E44d In Hex | 3e-08 | ||
| 2l5l_A | 136 | Solution Structure Of Thioredoxin From Bacteroides | 3e-08 | ||
| 1dby_A | 107 | Nmr Structures Of Chloroplast Thioredoxin M Ch2 Fro | 3e-08 | ||
| 3p2a_A | 148 | Crystal Structure Of Thioredoxin 2 From Yersinia Pe | 3e-08 | ||
| 2tir_A | 108 | Crystal Structure Analysis Of A Mutant Escherichia | 4e-08 | ||
| 3zzx_A | 105 | Crystallographic Structure Of Thioredoxin From Lito | 4e-08 | ||
| 3zzx_A | 105 | Crystallographic Structure Of Thioredoxin From Lito | 9e-06 | ||
| 1fb0_A | 105 | Crystal Structure Of Thioredoxin M From Spinach Chl | 4e-08 | ||
| 2h76_A | 108 | Crystal Structure Of Thioredoxin Mutant D10e In Hex | 4e-08 | ||
| 2h73_A | 108 | Crystal Structure Of Thioredoxin Mutant D43e In Hex | 4e-08 | ||
| 1gl8_A | 104 | Solution Structure Of Thioredoxin M From Spinach, O | 5e-08 | ||
| 2i4a_A | 107 | Crystal Structure Of Thioredoxin From The Acidophil | 6e-08 | ||
| 2i4a_A | 107 | Crystal Structure Of Thioredoxin From The Acidophil | 2e-04 | ||
| 1xw9_A | 106 | Drospohila Thioredoxin, Oxidized, P21 Length = 106 | 6e-08 | ||
| 1xw9_A | 106 | Drospohila Thioredoxin, Oxidized, P21 Length = 106 | 9e-06 | ||
| 1xwa_A | 111 | Drospohila Thioredoxin, Oxidized, P41212 Length = 1 | 7e-08 | ||
| 1xwa_A | 111 | Drospohila Thioredoxin, Oxidized, P41212 Length = 1 | 1e-05 | ||
| 2i9h_A | 103 | Nmr Solution Structure Of The Reduced Form Of Thior | 7e-08 | ||
| 3f3q_A | 109 | Crystal Structure Of The Oxidised Form Of Thioredox | 7e-08 | ||
| 2fch_A | 108 | Crystal Structure Of Thioredoxin Mutant G74s Length | 7e-08 | ||
| 1txx_A | 108 | Active-Site Variant Of E.Coli Thioredoxin Length = | 1e-07 | ||
| 2gzy_A | 104 | Solution Structures Of The Reduced Form Of Thioredo | 1e-07 | ||
| 2gzy_A | 104 | Solution Structures Of The Reduced Form Of Thioredo | 8e-05 | ||
| 2o8v_B | 128 | Paps Reductase In A Covalent Complex With Thioredox | 1e-07 | ||
| 1keb_A | 108 | Crystal Structure Of Double Mutant M37l,P40s E.Coli | 1e-07 | ||
| 3nof_A | 118 | Mycobacterium Tuberculosis Thioredoxin C C40s Mutan | 1e-07 | ||
| 1tho_A | 109 | Crystal Structure Of A Mutant Escherichia Coli Thio | 2e-07 | ||
| 1v98_A | 140 | Crystal Structure Analysis Of Thioredoxin From Ther | 2e-07 | ||
| 1v98_A | 140 | Crystal Structure Analysis Of Thioredoxin From Ther | 4e-04 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 2e-07 | ||
| 1f6m_C | 108 | Crystal Structure Of A Complex Between Thioredoxin | 2e-07 | ||
| 2o87_A | 106 | S. Aureus Thioredoxin P31s Mutant Length = 106 | 2e-07 | ||
| 2o85_A | 107 | S. Aureus Thioredoxin P31t Mutant Length = 107 | 3e-07 | ||
| 1srx_A | 108 | Three-Dimensional Structure Of Escherichia Coli Thi | 3e-07 | ||
| 4f9z_D | 227 | Crystal Structure Of Human Erp27 Length = 227 | 3e-07 | ||
| 2yj7_A | 106 | Crystal Structure Of A Hyperstable Protein From The | 3e-07 | ||
| 2yj7_A | 106 | Crystal Structure Of A Hyperstable Protein From The | 2e-06 | ||
| 2pu9_C | 111 | Crystal Srtucture Of The Binary Complex Between Fer | 3e-07 | ||
| 2o7k_A | 107 | S. Aureus Thioredoxin Length = 107 | 4e-07 | ||
| 3hyp_A | 141 | Crystal Structure Of Bacteroides Fragilis Trxp_s105 | 4e-07 | ||
| 2puk_C | 106 | Crystal Srtucture Of The Binary Complex Between Fer | 6e-07 | ||
| 1zcp_A | 108 | Crystal Structure Of A Catalytic Site Mutant E. Col | 8e-07 | ||
| 3f3r_A | 109 | Crystal Structure Of Yeast Thioredoxin1-Glutathione | 1e-06 | ||
| 2voc_A | 112 | Thioredoxin A Active Site Mutants Form Mixed Disulf | 1e-06 | ||
| 2ipa_A | 104 | Solution Structure Of Trx-Arsc Complex Length = 104 | 2e-06 | ||
| 3hxs_A | 141 | Crystal Structure Of Bacteroides Fragilis Trxp Leng | 2e-06 | ||
| 1wmj_A | 130 | Solution Structure Of Thioredoxin Type H From Oryza | 2e-06 | ||
| 2xbq_A | 117 | Crystal Structure Of Reduced Schistosoma Mansoni Th | 2e-06 | ||
| 1m7t_A | 107 | Solution Structure And Dynamics Of The Human-Escher | 2e-06 | ||
| 2xbi_A | 108 | Crystal Structure Of Schistosoma Mansoni Thioredoxi | 3e-06 | ||
| 1xfl_A | 124 | Solution Structure Of Thioredoxin H1 From Arabidops | 3e-06 | ||
| 2j23_A | 121 | Cross-Reactivity And Crystal Structure Of Malassezi | 3e-06 | ||
| 2o89_A | 107 | S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 | 4e-06 | ||
| 2fa4_A | 111 | Crystal Structure Of Oxidized Form From Saccharomyc | 4e-06 | ||
| 2fa4_A | 111 | Crystal Structure Of Oxidized Form From Saccharomyc | 6e-04 | ||
| 2hsy_A | 104 | Solution Structure Of Thioredoxin 2 From Saccharomy | 4e-06 | ||
| 2hsy_A | 104 | Solution Structure Of Thioredoxin 2 From Saccharomy | 6e-04 | ||
| 3ec3_A | 250 | Crystal Structure Of The Bb Fragment Of Erp72 Lengt | 8e-06 | ||
| 2f51_A | 118 | Structure Of Trichomonas Vaginalis Thioredoxin Leng | 1e-05 | ||
| 1oaz_A | 123 | Ige Fv Spe7 Complexed With A Recombinant Thioredoxi | 1e-05 | ||
| 3tco_A | 109 | Crystallographic And Spectroscopic Characterization | 1e-05 | ||
| 1t00_A | 112 | The Structure Of Thioredoxin From S. Coelicolor Len | 1e-05 | ||
| 1t00_A | 112 | The Structure Of Thioredoxin From S. Coelicolor Len | 2e-05 | ||
| 1r26_A | 125 | Crystal Structure Of Thioredoxin From Trypanosoma B | 2e-05 | ||
| 3qdn_A | 287 | Putative Thioredoxin Protein From Salmonella Typhim | 2e-05 | ||
| 3qdn_A | 287 | Putative Thioredoxin Protein From Salmonella Typhim | 4e-04 | ||
| 3die_A | 106 | Domain Swapping Of Staphylococcus Aureus Thioredoxi | 2e-05 | ||
| 2vm1_A | 118 | Crystal Structure Of Barley Thioredoxin H Isoform 1 | 2e-05 | ||
| 2vlt_A | 122 | Crystal Structure Of Barley Thioredoxin H Isoform 2 | 2e-05 | ||
| 1aiu_A | 105 | Human Thioredoxin (D60n Mutant, Reduced Form) Lengt | 2e-05 | ||
| 1ti3_A | 113 | Solution Structure Of The Thioredoxin H1 From Popla | 2e-05 | ||
| 2oe0_A | 114 | Crystal Structure Of Mitochondrial Thioredoxin 3 Fr | 4e-05 | ||
| 3d21_A | 139 | Crystal Structure Of A Poplar Wild-Type Thioredoxin | 4e-05 | ||
| 2hsh_A | 105 | Crystal Structure Of C73s Mutant Of Human Thioredox | 5e-05 | ||
| 3m9j_A | 105 | Crystal Structure Of Human Thioredoxin C6973S DOUBL | 5e-05 | ||
| 3aps_A | 122 | Crystal Structure Of Trx4 Domain Of Erdj5 Length = | 6e-05 | ||
| 3aps_A | 122 | Crystal Structure Of Trx4 Domain Of Erdj5 Length = | 5e-04 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 6e-05 | ||
| 4dss_B | 112 | Crystal Structure Of Peroxiredoxin Ahp1 From Saccha | 7e-05 | ||
| 2ifq_A | 105 | Crystal Structure Of S-Nitroso Thioredoxin Length = | 7e-05 | ||
| 3pin_A | 104 | Crystal Structure Of Mxr1 From Saccharomyces Cerevi | 7e-05 | ||
| 2ifq_B | 105 | Crystal Structure Of S-Nitroso Thioredoxin Length = | 7e-05 | ||
| 3vfi_A | 104 | Crystal Structure Of A Metagenomic Thioredoxin Leng | 8e-05 | ||
| 1trs_A | 105 | The High-Resolution Three-Dimensional Solution Stru | 8e-05 | ||
| 3qou_A | 287 | Crystal Structure Of E. Coli Ybbn Length = 287 | 1e-04 | ||
| 3qou_A | 287 | Crystal Structure Of E. Coli Ybbn Length = 287 | 3e-04 | ||
| 1thx_A | 115 | Thioredoxin-2 Length = 115 | 1e-04 | ||
| 3trx_A | 105 | High-Resolution Three-Dimensional Structure Of Redu | 1e-04 | ||
| 3kd0_A | 105 | Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showin | 3e-04 | ||
| 3bj5_A | 147 | Alternative Conformations Of The X Region Of Human | 4e-04 | ||
| 2iwt_A | 125 | Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Compl | 4e-04 |
| >pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 | Back alignment and structure |
|
| >pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 | Back alignment and structure |
| >pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 | Back alignment and structure |
| >pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 | Back alignment and structure |
| >pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 | Back alignment and structure |
| >pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 | Back alignment and structure |
| >pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 | Back alignment and structure |
| >pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 | Back alignment and structure |
| >pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 | Back alignment and structure |
| >pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 | Back alignment and structure |
| >pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 | Back alignment and structure |
| >pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 | Back alignment and structure |
| >pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 | Back alignment and structure |
| >pdb|2DJJ|A Chain A, Solution Structure Of The A' Domain Of Thermophilic Fungal Protein Disulfide Isomerase Length = 121 | Back alignment and structure |
| >pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 | Back alignment and structure |
| >pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 | Back alignment and structure |
| >pdb|1X5C|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase Length = 121 | Back alignment and structure |
| >pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 | Back alignment and structure |
| >pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 | Back alignment and structure |
| >pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 | Back alignment and structure |
| >pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 | Back alignment and structure |
| >pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 | Back alignment and structure |
| >pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 | Back alignment and structure |
| >pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 | Back alignment and structure |
| >pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 | Back alignment and structure |
| >pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 | Back alignment and structure |
| >pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 | Back alignment and structure |
| >pdb|2R2J|A Chain A, Crystal Structure Of Human Erp44 Length = 382 | Back alignment and structure |
| >pdb|2R2J|A Chain A, Crystal Structure Of Human Erp44 Length = 382 | Back alignment and structure |
| >pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 | Back alignment and structure |
| >pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 | Back alignment and structure |
| >pdb|2H8L|A Chain A, Crystal Structure Of The Bb' Fragment Of Erp57 Length = 252 | Back alignment and structure |
| >pdb|2PPT|A Chain A, Crystal Structure Of Thioredoxin-2 Length = 155 | Back alignment and structure |
| >pdb|2PPT|A Chain A, Crystal Structure Of Thioredoxin-2 Length = 155 | Back alignment and structure |
| >pdb|1UVZ|A Chain A, Structure Of Human Thioredoxin 2 Length = 119 | Back alignment and structure |
| >pdb|1UVZ|A Chain A, Structure Of Human Thioredoxin 2 Length = 119 | Back alignment and structure |
| >pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 | Back alignment and structure |
| >pdb|3Q6O|A Chain A, Oxidoreductase Fragment Of Human Qsox1 Length = 244 | Back alignment and structure |
| >pdb|3Q6O|A Chain A, Oxidoreductase Fragment Of Human Qsox1 Length = 244 | Back alignment and structure |
| >pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 | Back alignment and structure |
| >pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 | Back alignment and structure |
| >pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 | Back alignment and structure |
| >pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin Length = 104 | Back alignment and structure |
| >pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin Length = 104 | Back alignment and structure |
| >pdb|1X5E|A Chain A, The Solution Structure Of The Thioredoxin-Like Domain Of Human Thioredoxin-Related Transmembrane Protein Length = 126 | Back alignment and structure |
| >pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 | Back alignment and structure |
| >pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 | Back alignment and structure |
| >pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|3T58|A Chain A, C76aC455S MUTANT OF MOUSE QSOX1 CONTAINING AN INTERDOMAIN DISULFIDE Length = 519 | Back alignment and structure |
| >pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2CVK|A Chain A, Crystal Structure Of Thermus Thermophilus Thioredoxin Length = 110 | Back alignment and structure |
| >pdb|2CVK|A Chain A, Crystal Structure Of Thermus Thermophilus Thioredoxin Length = 110 | Back alignment and structure |
| >pdb|2YZU|A Chain A, Crystal Structure Of Oxidized Thioredoxin From Thermus Thermophilus Hb8 Length = 109 | Back alignment and structure |
| >pdb|2YZU|A Chain A, Crystal Structure Of Oxidized Thioredoxin From Thermus Thermophilus Hb8 Length = 109 | Back alignment and structure |
| >pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures Length = 108 | Back alignment and structure |
| >pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At 1.68 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|1RQM|A Chain A, Solution Structure Of The K18gR82E ALICYCLOBACILLUS Acidocaldarius Thioredoxin Mutant Length = 105 | Back alignment and structure |
| >pdb|1RQM|A Chain A, Solution Structure Of The K18gR82E ALICYCLOBACILLUS Acidocaldarius Thioredoxin Mutant Length = 105 | Back alignment and structure |
| >pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In Its Oxidized Form Length = 111 | Back alignment and structure |
| >pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|2K18|A Chain A, Solution Structure Of Bb' Domains Of Human Protein Disulfide Isomerase Length = 228 | Back alignment and structure |
| >pdb|2EIQ|A Chain A, Design Of Disulfide-linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|1FAA|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Long Form) Length = 124 | Back alignment and structure |
| >pdb|2E0Q|A Chain A, Crystal Structure Of K53e Thioredoxin From Sulfolobus Tokodaii Strain7 Length = 104 | Back alignment and structure |
| >pdb|1F9M|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Short Form) Length = 112 | Back alignment and structure |
| >pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C Length = 121 | Back alignment and structure |
| >pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108 | Back alignment and structure |
| >pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|2L4Q|A Chain A, Solution Structures Of Oxidized And Reduced Thioredoxin C From M. Tb Length = 116 | Back alignment and structure |
| >pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2L5L|A Chain A, Solution Structure Of Thioredoxin From Bacteroides Vulgatus Length = 136 | Back alignment and structure |
| >pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The Green Alga Chlamydomonas Reinhardtii Length = 107 | Back alignment and structure |
| >pdb|3P2A|A Chain A, Crystal Structure Of Thioredoxin 2 From Yersinia Pestis Length = 148 | Back alignment and structure |
| >pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli Thioredoxin In Which Lysine 36 Is Replaced By Glutamic Acid Length = 108 | Back alignment and structure |
| >pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei Length = 105 | Back alignment and structure |
| >pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei Length = 105 | Back alignment and structure |
| >pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 | Back alignment and structure |
| >pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 | Back alignment and structure |
| >pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile Acetobacter Aceti Length = 107 | Back alignment and structure |
| >pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile Acetobacter Aceti Length = 107 | Back alignment and structure |
| >pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21 Length = 106 | Back alignment and structure |
| >pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21 Length = 106 | Back alignment and structure |
| >pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 Length = 111 | Back alignment and structure |
| >pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 Length = 111 | Back alignment and structure |
| >pdb|2I9H|A Chain A, Nmr Solution Structure Of The Reduced Form Of Thioredoxin 1 From Yeast (Trx1) Length = 103 | Back alignment and structure |
| >pdb|3F3Q|A Chain A, Crystal Structure Of The Oxidised Form Of Thioredoxin 1 From Saccharomyces Cerevisiae Length = 109 | Back alignment and structure |
| >pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s Length = 108 | Back alignment and structure |
| >pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 | Back alignment and structure |
| >pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 | Back alignment and structure |
| >pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128 | Back alignment and structure |
| >pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|3NOF|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant Length = 118 | Back alignment and structure |
| >pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin With An Arginine Insertion In The Active Site Length = 109 | Back alignment and structure |
| >pdb|1V98|A Chain A, Crystal Structure Analysis Of Thioredoxin From Thermus Thermophilus Length = 140 | Back alignment and structure |
| >pdb|1V98|A Chain A, Crystal Structure Analysis Of Thioredoxin From Thermus Thermophilus Length = 140 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 108 | Back alignment and structure |
| >pdb|2O87|A Chain A, S. Aureus Thioredoxin P31s Mutant Length = 106 | Back alignment and structure |
| >pdb|2O85|A Chain A, S. Aureus Thioredoxin P31t Mutant Length = 107 | Back alignment and structure |
| >pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli Thioredoxin-S2 To 2.8 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|4F9Z|D Chain D, Crystal Structure Of Human Erp27 Length = 227 | Back alignment and structure |
| >pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 | Back alignment and structure |
| >pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 | Back alignment and structure |
| >pdb|2PU9|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin F Length = 111 | Back alignment and structure |
| >pdb|2O7K|A Chain A, S. Aureus Thioredoxin Length = 107 | Back alignment and structure |
| >pdb|3HYP|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp_s105g Mutant Length = 141 | Back alignment and structure |
| >pdb|2PUK|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin M Length = 106 | Back alignment and structure |
| >pdb|1ZCP|A Chain A, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa (Caca) Length = 108 | Back alignment and structure |
| >pdb|3F3R|A Chain A, Crystal Structure Of Yeast Thioredoxin1-Glutathione Mixed Disulfide Complex Length = 109 | Back alignment and structure |
| >pdb|2VOC|A Chain A, Thioredoxin A Active Site Mutants Form Mixed Disulfide Dimers That Resemble Enzyme-substrate Reaction Intermediate Length = 112 | Back alignment and structure |
| >pdb|2IPA|A Chain A, Solution Structure Of Trx-Arsc Complex Length = 104 | Back alignment and structure |
| >pdb|3HXS|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp Length = 141 | Back alignment and structure |
| >pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza Sativa Length = 130 | Back alignment and structure |
| >pdb|2XBQ|A Chain A, Crystal Structure Of Reduced Schistosoma Mansoni Thioredoxin Pre-Protein At 1.7 Angstrom Length = 117 | Back alignment and structure |
| >pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human-Escherichia Coli Thioredoxin Chimera: Insights Into Thermodynamic Stability Length = 107 | Back alignment and structure |
| >pdb|2XBI|A Chain A, Crystal Structure Of Schistosoma Mansoni Thioredoxin At 1.6 Angstrom Length = 108 | Back alignment and structure |
| >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 | Back alignment and structure |
| >pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 | Back alignment and structure |
| >pdb|2O89|A Chain A, S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 | Back alignment and structure |
| >pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 | Back alignment and structure |
| >pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 | Back alignment and structure |
| >pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 | Back alignment and structure |
| >pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 | Back alignment and structure |
| >pdb|3EC3|A Chain A, Crystal Structure Of The Bb Fragment Of Erp72 Length = 250 | Back alignment and structure |
| >pdb|2F51|A Chain A, Structure Of Trichomonas Vaginalis Thioredoxin Length = 118 | Back alignment and structure |
| >pdb|1OAZ|A Chain A, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin Length = 123 | Back alignment and structure |
| >pdb|3TCO|A Chain A, Crystallographic And Spectroscopic Characterization Of Sulfolobus Solfataricus Trxa1 Provide Insights Into The Determinants Of Thioredoxin Fold Stability Length = 109 | Back alignment and structure |
| >pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 | Back alignment and structure |
| >pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 | Back alignment and structure |
| >pdb|1R26|A Chain A, Crystal Structure Of Thioredoxin From Trypanosoma Brucei Brucei Length = 125 | Back alignment and structure |
| >pdb|3QDN|A Chain A, Putative Thioredoxin Protein From Salmonella Typhimurium Length = 287 | Back alignment and structure |
| >pdb|3QDN|A Chain A, Putative Thioredoxin Protein From Salmonella Typhimurium Length = 287 | Back alignment and structure |
| >pdb|3DIE|A Chain A, Domain Swapping Of Staphylococcus Aureus Thioredoxin W28a Mutant Length = 106 | Back alignment and structure |
| >pdb|2VM1|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 Crystallized Using Ammonium Sulfate As Precipitant Length = 118 | Back alignment and structure |
| >pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State Length = 122 | Back alignment and structure |
| >pdb|1AIU|A Chain A, Human Thioredoxin (D60n Mutant, Reduced Form) Length = 105 | Back alignment and structure |
| >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 | Back alignment and structure |
| >pdb|2OE0|A Chain A, Crystal Structure Of Mitochondrial Thioredoxin 3 From Saccharomyces Cerevisiae Length = 114 | Back alignment and structure |
| >pdb|3D21|A Chain A, Crystal Structure Of A Poplar Wild-Type Thioredoxin H, Pttrxh4 Length = 139 | Back alignment and structure |
| >pdb|2HSH|A Chain A, Crystal Structure Of C73s Mutant Of Human Thioredoxin-1 Oxidized With H2o2 Length = 105 | Back alignment and structure |
| >pdb|3M9J|A Chain A, Crystal Structure Of Human Thioredoxin C6973S DOUBLE MUTANT, REDUCED Form Length = 105 | Back alignment and structure |
| >pdb|3APS|A Chain A, Crystal Structure Of Trx4 Domain Of Erdj5 Length = 122 | Back alignment and structure |
| >pdb|3APS|A Chain A, Crystal Structure Of Trx4 Domain Of Erdj5 Length = 122 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|4DSS|B Chain B, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Complex With Thioredoxin Trx2 Length = 112 | Back alignment and structure |
| >pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|3PIN|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Complex With Trx2 Length = 104 | Back alignment and structure |
| >pdb|2IFQ|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|3VFI|A Chain A, Crystal Structure Of A Metagenomic Thioredoxin Length = 104 | Back alignment and structure |
| >pdb|1TRS|A Chain A, The High-Resolution Three-Dimensional Solution Structures Of The Oxidized And Reduced States Of Human Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|3QOU|A Chain A, Crystal Structure Of E. Coli Ybbn Length = 287 | Back alignment and structure |
| >pdb|3QOU|A Chain A, Crystal Structure Of E. Coli Ybbn Length = 287 | Back alignment and structure |
| >pdb|1THX|A Chain A, Thioredoxin-2 Length = 115 | Back alignment and structure |
| >pdb|3TRX|A Chain A, High-Resolution Three-Dimensional Structure Of Reduced Recombinant Human Thioredoxin In Solution Length = 105 | Back alignment and structure |
| >pdb|3KD0|A Chain A, Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showing Cadmium Chloride Bound To The Active Site Length = 105 | Back alignment and structure |
| >pdb|3BJ5|A Chain A, Alternative Conformations Of The X Region Of Human Protein Disulphide- Isomerase Modulate Exposure Of The Substrate Binding B' Domain Length = 147 | Back alignment and structure |
| >pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Complex With The Target Protein Basi Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 500 | |||
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 1e-116 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 7e-32 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 1e-115 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 1e-27 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 2e-96 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 2e-27 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 1e-10 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 8e-92 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 1e-23 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 8e-85 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-59 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 5e-42 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 9e-15 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 4e-82 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 1e-19 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 5e-04 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 3e-75 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 1e-20 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 1e-06 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 3e-63 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 1e-26 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 2e-10 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 8e-58 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 5e-33 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 4e-55 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 1e-37 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 7e-54 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 4e-39 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 1e-32 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 2e-27 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 7e-51 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 1e-31 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 3e-50 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 4e-35 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 2e-49 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 3e-38 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 4e-49 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 8e-37 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 4e-49 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 2e-38 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 7e-49 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 6e-48 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 8e-39 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 2e-47 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 4e-45 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 2e-34 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 5e-43 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 1e-25 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 5e-42 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 9e-27 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 3e-16 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 6e-14 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 1e-38 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 2e-26 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-37 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 6e-29 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 7e-31 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 5e-20 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 9e-27 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 4e-25 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 2e-24 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 4e-22 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 7e-12 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 1e-21 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 5e-18 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 5e-20 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 5e-12 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 3e-19 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 3e-13 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 8e-19 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 7e-15 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 1e-18 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 1e-14 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 4e-18 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 7e-12 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 8e-18 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 2e-10 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 1e-17 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 1e-16 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 1e-17 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 3e-15 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 2e-17 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 7e-14 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 2e-17 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 5e-12 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 3e-17 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 7e-12 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 4e-17 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 4e-11 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 4e-17 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 1e-11 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 5e-17 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 1e-11 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 8e-17 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 6e-15 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 1e-16 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 5e-12 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 1e-16 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 4e-16 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 1e-16 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 1e-15 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 2e-16 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 3e-09 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 2e-16 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 6e-11 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 2e-16 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 8e-14 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 2e-16 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 9e-10 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 3e-16 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 9e-10 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 3e-16 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 8e-16 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 3e-16 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 3e-10 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 4e-16 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 8e-14 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 4e-16 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 1e-14 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 8e-14 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 9e-12 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 5e-16 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 2e-10 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 5e-16 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 6e-11 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 6e-16 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 7e-09 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 8e-16 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 5e-14 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 1e-15 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 3e-10 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 1e-15 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 1e-10 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 2e-15 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 2e-10 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 2e-15 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 2e-10 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 2e-15 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 1e-14 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 3e-15 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 1e-13 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 3e-15 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 6e-14 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 4e-15 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 1e-10 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 4e-15 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 2e-14 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 5e-15 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 5e-14 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 7e-15 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 7e-14 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 9e-15 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 2e-09 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 1e-14 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 8e-14 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 1e-14 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 1e-10 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 2e-14 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 7e-14 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 2e-14 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 5e-14 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 2e-14 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 1e-13 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 3e-14 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 7e-14 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 3e-14 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 5e-14 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 3e-14 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 5e-11 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 3e-14 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 1e-12 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 4e-14 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 2e-12 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 4e-14 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 2e-13 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 5e-14 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 9e-14 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 6e-14 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 5e-12 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 7e-14 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 9e-14 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 8e-14 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 3e-13 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 2e-13 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 1e-12 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 3e-13 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 5e-12 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-13 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 1e-10 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 4e-13 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 3e-10 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 5e-13 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 1e-11 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 8e-13 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 2e-08 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 1e-12 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 4e-11 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 1e-12 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 3e-08 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 4e-12 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 6e-11 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 8e-12 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 7e-09 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 2e-11 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 4e-09 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 1e-10 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 9e-08 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 2e-09 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 3e-09 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 1e-04 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 4e-09 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 3e-08 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 3e-08 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 1e-04 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 6e-08 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 5e-04 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 1e-07 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 2e-06 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 1e-07 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 2e-07 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 2e-07 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 5e-05 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 3e-07 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 3e-07 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 3e-06 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 7e-07 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 4e-05 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 8e-07 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 8e-04 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 8e-07 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 2e-06 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 9e-07 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 1e-06 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 6e-06 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 1e-06 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 2e-06 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 1e-06 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 1e-04 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 2e-06 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 2e-04 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 2e-06 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 4e-06 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 6e-06 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 9e-05 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 7e-06 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 7e-04 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 7e-06 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 3e-04 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 9e-06 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 1e-05 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 7e-04 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 2e-05 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 1e-04 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 2e-05 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 3e-04 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 3e-05 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 7e-05 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 3e-05 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 7e-05 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 9e-05 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 1e-04 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 5e-04 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 1e-04 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 1e-04 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 3e-04 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 1e-04 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 2e-04 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 2e-04 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 4e-04 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 2e-04 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 6e-04 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 3e-04 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 5e-04 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 5e-04 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 6e-04 |
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
Score = 351 bits (901), Expect = e-116
Identities = 139/501 (27%), Positives = 232/501 (46%), Gaps = 43/501 (8%)
Query: 21 ISAEESAESKEFVLTLDHSNFSDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASELSSH 80
+ E A V+ L +F++ + H+ ++ EF+APWCGHCK +APEY KAA L
Sbjct: 4 MQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEK 63
Query: 81 DPPVVLAKVDANEEANKELASQYEIRGFPTIKILRNGGKT-IQEYKGPREADGIVEYLKK 139
+ + LA++D E N++L ++ I GFP++KI +N +Y+GPR A+ IV+++ K
Sbjct: 64 N--ITLAQIDCTE--NQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIK 119
Query: 140 QSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNA 199
QS PA A + + +I + + ++A K +DY+F +NA
Sbjct: 120 QSQPAVAVVADLPAYLANE-TFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENA 178
Query: 200 KLLPRGESSVTGPVVRLFKPFDELFVDF----KDFKVDALEKFVEESSIPIVTVFNSDAN 255
+ L DE V D EK+++ ++P +
Sbjct: 179 D-------DDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGS-- 229
Query: 256 NHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAF 315
++ S LF N E E + + E+A++ +G ++F+ D
Sbjct: 230 ---VFAQYVESGLPLGYLFYN-DEEELEEYKPLFTELAKKNRGL-MNFVSIDARKFGRHA 284
Query: 316 QYFGLQESQVPLIVIQTNDGQKYLKPN--------------LDADQIAPWVKEYKEGKVP 361
++E + + KY P L++ I VK++ +G
Sbjct: 285 GNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDAS 344
Query: 362 PFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVS 421
P KS+ I E + V LV + ++V + K+VL+ +YAPWCGHCK+LAP E+A +
Sbjct: 345 PIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADT 404
Query: 422 YQN-DADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKT--VPYEGDRTKEDIVDFI 478
Y N +DV+IAK D T ND+ G ++GYPT+ K+ V Y+G R+ + + DFI
Sbjct: 405 YANATSDVLIAKLDHTENDVRG--VVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI 462
Query: 479 ENNRDKAAPKETVKEESGKDE 499
+ N + + EE+ +
Sbjct: 463 KENGHFDVDGKALYEEAQEKA 483
|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Length = 252 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Length = 226 | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Length = 226 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Length = 106 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Length = 116 | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Length = 243 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Length = 243 | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Length = 164 | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Length = 291 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Length = 154 | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Length = 143 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Length = 143 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Length = 137 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Length = 137 | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Length = 154 | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Length = 165 | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Length = 165 | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Length = 151 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Length = 147 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Length = 143 | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Length = 144 | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Length = 144 | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Length = 144 | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Length = 150 | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Length = 152 | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Length = 165 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 100.0 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 100.0 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 100.0 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 100.0 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 100.0 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 100.0 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 100.0 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 100.0 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.97 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.97 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.96 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 99.96 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.92 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.87 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.86 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.86 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.84 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.84 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.83 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.83 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.83 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.82 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.81 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.81 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.8 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.79 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.79 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.78 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.77 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.77 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.77 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.77 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.77 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.77 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.77 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.76 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.76 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 99.76 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.76 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.76 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.75 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.75 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.75 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.75 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.75 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.75 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.75 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.75 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.75 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.75 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 99.74 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.74 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.74 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.74 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.74 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.74 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.74 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.73 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.73 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.73 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.73 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.73 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.73 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.73 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.73 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.73 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.73 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.72 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.72 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.72 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.72 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.72 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.72 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.72 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.72 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.72 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.72 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.71 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.71 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.71 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.71 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.71 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.71 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.71 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.71 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.71 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.71 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.71 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.71 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.71 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.7 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.7 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.7 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.7 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.7 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.7 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.69 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.69 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.69 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.69 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.69 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.69 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.69 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.69 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.69 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.69 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.69 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.69 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.68 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.68 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.68 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.68 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.68 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.68 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.68 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.68 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.68 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.68 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.68 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.68 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.68 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.68 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.68 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.67 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.67 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.67 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.67 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.67 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.67 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.67 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.67 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.67 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.67 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.66 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.66 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.65 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.65 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.65 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.65 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.64 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.64 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.64 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.63 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.63 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.63 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.63 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.63 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.63 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.63 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.62 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.62 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.62 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.62 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.62 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.62 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.62 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.62 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 99.62 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.62 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.61 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.61 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.61 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.61 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.61 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.6 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.6 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.6 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.6 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.6 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.6 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.6 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.59 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.59 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.59 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 99.37 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.59 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.59 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.59 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.58 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.58 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.58 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.57 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.57 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.57 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.57 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 99.33 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.55 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.55 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.55 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.55 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.55 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.55 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.54 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.54 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.54 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.53 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.52 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.51 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.51 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.5 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.49 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.49 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.49 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 99.49 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 99.23 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 99.48 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.48 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.48 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 99.48 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 99.47 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.46 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 99.46 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.45 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.45 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 99.45 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.45 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.44 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.44 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.44 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.44 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 99.43 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 99.42 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 99.42 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.41 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 99.41 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.4 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.4 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.4 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 99.38 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 99.37 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 99.36 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 99.36 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 99.05 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 99.36 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 99.36 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 99.35 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 99.35 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 99.34 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 99.34 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 99.34 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 99.34 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.33 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 99.32 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 99.31 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 99.31 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 99.31 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 99.31 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.31 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 99.31 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 99.3 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 99.3 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 99.29 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 99.29 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.29 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.28 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 99.27 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 99.26 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 99.26 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 99.26 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 99.26 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 99.25 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 99.25 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 99.23 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 99.23 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 99.22 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 99.21 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 99.21 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 99.21 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.21 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 99.21 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 99.2 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 99.2 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 99.2 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 99.19 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 99.19 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 99.18 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 99.18 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 99.17 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 99.17 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 99.16 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 99.16 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.15 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 99.15 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 99.14 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 99.14 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 99.13 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 99.13 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 99.13 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.12 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 99.12 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 99.11 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 99.11 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 99.11 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 99.1 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.09 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.09 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 99.09 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 99.09 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 99.08 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 99.07 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 99.07 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 99.06 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 99.06 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 99.06 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.06 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 99.06 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 99.05 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 99.05 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 99.04 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 99.04 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 99.04 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 99.03 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 99.03 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 99.03 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 99.02 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 99.02 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 99.01 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 99.01 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 99.0 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 98.99 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 98.53 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.98 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 98.98 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.96 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 98.94 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 98.93 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 98.47 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.93 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 98.92 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.92 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 98.92 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 98.92 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 98.92 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 98.92 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 98.92 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 98.91 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.91 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 98.89 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 98.89 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 98.87 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 98.87 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 98.87 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 98.87 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 98.85 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 98.83 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 98.82 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 98.81 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 98.29 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 98.28 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 98.79 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 98.78 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.76 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 98.75 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.74 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.74 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 98.73 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.71 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 98.71 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.7 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 98.7 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 98.7 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.7 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 98.69 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 98.68 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 98.68 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 98.68 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 98.67 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 98.66 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 98.66 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 98.65 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.64 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 98.63 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 98.63 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 98.63 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 98.61 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 98.61 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 98.6 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 98.6 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 98.59 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 98.57 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 98.57 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.54 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 98.54 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 98.53 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 98.53 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 98.52 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 98.5 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.5 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 98.48 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 98.48 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 98.47 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 98.45 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 98.43 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 98.43 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 98.43 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 98.4 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 98.39 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 98.39 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.37 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 98.37 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 98.35 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 98.33 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 98.33 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 98.32 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 98.32 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 98.31 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 98.28 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 98.28 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 98.28 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 98.27 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 98.27 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 98.26 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 98.26 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 98.26 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 98.25 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 98.22 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 98.22 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 98.2 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 98.19 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 98.19 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 98.19 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 98.19 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 98.17 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.17 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 98.15 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 98.14 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.13 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 98.13 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 98.13 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.13 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 98.11 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.1 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 98.1 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 98.1 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 98.07 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 98.04 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 98.02 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 97.97 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 97.97 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 97.96 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 97.93 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 97.92 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 97.91 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 97.9 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 97.9 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 97.88 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 97.88 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 97.86 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 97.84 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 97.83 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 97.8 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 97.8 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 97.8 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 97.79 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 97.79 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 97.77 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 97.76 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 97.76 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 97.75 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 97.73 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 97.73 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 97.73 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 97.72 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 97.72 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 97.7 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 97.69 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 97.68 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 97.66 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 97.66 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 97.64 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 97.63 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 97.62 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 97.61 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 97.6 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 97.58 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 97.56 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 97.54 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 97.53 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 97.52 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.52 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 97.5 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 97.48 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 97.48 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 97.48 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 97.45 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 97.44 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 97.42 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 97.4 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 97.39 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 97.39 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 97.37 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 97.37 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 97.35 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 97.29 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 97.28 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 97.26 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.26 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 97.22 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 97.22 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.21 |
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.8e-64 Score=506.67 Aligned_cols=441 Identities=35% Similarity=0.667 Sum_probs=398.6
Q ss_pred CceEEcCccChhhhhccC---CeEEEEEECCCChhhhhhhHHHHHHHHHhcCCCCCeEEEEEecChhhhHHHHHhcCccc
Q 010804 31 EFVLTLDHSNFSDTVSKH---NFIVVEFYAPWCGHCKKLAPEYEKAASELSSHDPPVVLAKVDANEEANKELASQYEIRG 107 (500)
Q Consensus 31 ~~v~~l~~~~~~~~~~~~---~~~lv~f~~~~c~~C~~~~~~~~~~~~~~~~~~~~v~~~~vd~~~~~~~~~~~~~~i~~ 107 (500)
+.|..|++++|+..+.++ ++++|+||++||++|+++.|.|+++++.+.+. +.++.|||+.+.. +|++|+|++
T Consensus 1 s~v~~l~~~~f~~~i~~~~~~~~~lv~F~a~wC~~C~~~~p~~~~~a~~~~~~---v~~~~vd~~~~~~--l~~~~~v~~ 75 (481)
T 3f8u_A 1 SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHAKRLAPEYEAAATRLKGI---VPLAKVDCTANTN--TCNKYGVSG 75 (481)
T ss_dssp CCCEEECTTTHHHHTTCCSSSSEEEEEEECTTCHHHHHHHHHHHHHHHHTTTT---CCEEEEETTTCHH--HHHHTTCCE
T ss_pred CceEEecHHHHHHHHHhCCCCCeEEEEEECCCCHHHHHhHHHHHHHHHHhcCc---eEEEEEECCCCHH--HHHhcCCCC
Confidence 357899999999999887 99999999999999999999999999999875 9999999999888 999999999
Q ss_pred ccEEEEEecCCceeeecCCCCCHHHHHHHHHhhcCCCccccCChhhHhhhhccCCeEEEEEecCCCchhHHHHHHHHHHh
Q 010804 108 FPTIKILRNGGKTIQEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKL 187 (500)
Q Consensus 108 ~P~~~~~~~~~~~~~~~~g~~~~~~l~~~i~~~~~~~~~~i~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~f~~~a~~~ 187 (500)
+||+++|++| +.+.+|.|.++.+.|.+|+.+.++|.+.++++.++++++++.+...++++|.+.++...+.|.++|..+
T Consensus 76 ~Ptl~~~~~g-~~~~~~~G~~~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~vv~~~~~~~~~~~~~f~~~a~~~ 154 (481)
T 3f8u_A 76 YPTLKIFRDG-EEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNL 154 (481)
T ss_dssp ESEEEEEETT-EEEEECCSCSSHHHHHHHHHHHTSCSEEEECSHHHHHHHTTSSSCEEEEEESCTTCHHHHHHHHHHHHH
T ss_pred CCEEEEEeCC-ceeeeecCccCHHHHHHHHHhhcccCceecCCHHHHHHHHhcCCcEEEEEECCCccchHHHHHHHHHHh
Confidence 9999999976 678899999999999999999999999999999999999999999999999988999999999999999
Q ss_pred cCCceEEEeecccccCCCCCCCCCCeEEEec------cCCCcc-ccc-CCCCHHHHHHHHHHccCCcEEEeCCCCCCccc
Q 010804 188 RSDYEFGHTQNAKLLPRGESSVTGPVVRLFK------PFDELF-VDF-KDFKVDALEKFVEESSIPIVTVFNSDANNHPF 259 (500)
Q Consensus 188 ~~~~~f~~~~~~~~~~~~~~~~~~p~~~~~~------~~~~~~-~~~-~~~~~~~l~~~i~~~~~p~~~~~~~~~~~~~~ 259 (500)
++++.|+.+.+.+++++ ++++.+.+++|+ ..+... .|. |.++.++|.+||..+++|++++++. .|
T Consensus 155 ~~~~~F~~~~~~~~~~~--~~v~~~~i~~~~p~~~~~~~~~~~~~y~~~~~~~~~l~~fi~~~~~p~v~e~t~-----~n 227 (481)
T 3f8u_A 155 RDNYRFAHTNVESLVNE--YDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTE-----DN 227 (481)
T ss_dssp TTTSCEEEECCHHHHHH--HCSSSEEEEEECCGGGCBTTBCSEEECCCSSCCHHHHHHHHHHHTTTTSCEECT-----TT
T ss_pred ccCceEEEECCHHHHHH--hCCCCCcEEEEecccccCccCCcccccCCCCCCHHHHHHHHHHhCCCCccccCh-----hH
Confidence 99999999999999999 888888899999 444444 777 8899999999999999999999999 68
Q ss_pred hhhhhcCCCceEEEEEeCCCCCc----hHHHHHHHHHHHhhcCce--eEEEEEcccchhhHHhhcCCC--CCCCceEEEE
Q 010804 260 VIKFFNSPNAKAMLFMNFSSEGT----EPIQSKYREVAEQYKGQG--ISFLLGDLEASQGAFQYFGLQ--ESQVPLIVIQ 331 (500)
Q Consensus 260 ~~~~~~~~~~~~~l~~~~~~~~~----~~~~~~l~~va~~~~~~~--~~f~~~d~~~~~~~~~~~gi~--~~~~P~i~i~ 331 (500)
...++.. +++++|+..+.... +.+.+.++++|.+|+++. +.|+++|+..++..++.||++ ..+.|.++++
T Consensus 228 ~~~~~~~--~~~v~~~~~~~~~~~~~~~~~~~~~~~vA~~~~~k~~~i~F~~~D~~~~~~~l~~~gl~~~~~~~P~~~i~ 305 (481)
T 3f8u_A 228 KDLIQGK--DLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIR 305 (481)
T ss_dssp HHHHTTS--SEEEEEECCCTTTCHHHHHHHHHHHHHHHHHHHHTTCCCEEEEEETTTTHHHHGGGTCCCCTTCSCEEEEE
T ss_pred HHHhcCC--CceEEEEecccccchhhHHHHHHHHHHHHHHhcCCCceEEEEEEcHHHHHHHHHHcCCCcccCCCcEEEEE
Confidence 8888754 55555555433332 236788999999998864 999999999999999999998 4589999999
Q ss_pred eCCCCcc-CCCCCChh--hHHHHHHHHhcCCCCCccccCCCCCCCCCCeEEEeccchhhhhhcCCCeEEEEEECCCChhH
Q 010804 332 TNDGQKY-LKPNLDAD--QIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHC 408 (500)
Q Consensus 332 ~~~~~~y-~~~~~~~~--~i~~fi~~~~~G~l~~~~~s~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~v~f~~~~c~~c 408 (500)
+.++.+| +.++++.+ .|.+|++++++|+++++++|+++|+.....+..+++++|+..+.+.+++++|+||++||++|
T Consensus 306 ~~~~~ky~~~~~~t~e~~~l~~f~~~~~~g~~~~~~~s~~~p~~~~~~v~~~~~~~~~~~~~~~~k~vlv~f~a~wC~~C 385 (481)
T 3f8u_A 306 TAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHC 385 (481)
T ss_dssp CSSSCEEECCSCCCTTSHHHHHHHHHHHHTCCCCCCCCCCCCSCCCSSSEEECTTTHHHHHTCTTCEEEEEEECTTBHHH
T ss_pred cCCCcccCCCcccCccHHHHHHHHHHHhcCCcccccccCCCCCCCCCCeEEecccCHHHHhhcCCCcEEEEEecCcChhH
Confidence 9666788 88899999 99999999999999999999999988888899999999999997779999999999999999
Q ss_pred hhhhHHHHHHHHHcCCCCceEEEEEeCCCCCCCCCCCCcCcceEEEEEcCCCc--eEEecCCCCHHHHHHHHHhhcCCCC
Q 010804 409 KKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGK--TVPYEGDRTKEDIVDFIENNRDKAA 486 (500)
Q Consensus 409 ~~~~~~~~~~~~~~~~~~~~~~~~id~~~~~~~~~~~~i~~~P~~~~~~~~~~--~~~~~g~~~~~~l~~~i~~~~~~~~ 486 (500)
+.+.|.|.+++..+++..++.++++|++.+ .+++++++.++|++++|++|++ +.+|.|.++.++|.+||+++++.+.
T Consensus 386 ~~~~p~~~~l~~~~~~~~~v~~~~id~~~~-~~~~~~~v~~~Pt~~~~~~~~~~~~~~~~G~~~~~~l~~~l~~~~~~~~ 464 (481)
T 3f8u_A 386 KNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPP 464 (481)
T ss_dssp HHHHHHHHHHHHHTTTCSSEEEEEEETTSS-CCCTTCCCCSSSEEEEECTTCTTSCEECCSCCSHHHHHHHHHHHCSSCC
T ss_pred HHhhHHHHHHHHHhccCCCEEEEEEECCch-hhHhhCCCcccCEEEEEeCCCeEeeeEeCCCCCHHHHHHHHHHhcCCcc
Confidence 999999999999998766899999999998 5666799999999999998887 7899999999999999999987654
Q ss_pred C
Q 010804 487 P 487 (500)
Q Consensus 487 ~ 487 (500)
.
T Consensus 465 ~ 465 (481)
T 3f8u_A 465 V 465 (481)
T ss_dssp C
T ss_pred c
Confidence 3
|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 500 | ||||
| d2c0ga2 | 122 | c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma | 8e-30 | |
| d2c0ga2 | 122 | c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma | 5e-18 | |
| d1g7ea_ | 122 | c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, | 1e-24 | |
| d1g7ea_ | 122 | c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, | 2e-17 | |
| d1meka_ | 120 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 3e-22 | |
| d1meka_ | 120 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 2e-13 | |
| d1bjxa_ | 110 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 8e-22 | |
| d2b5ea1 | 140 | c.47.1.2 (A:365-504) Protein disulfide isomerase, | 8e-22 | |
| d2b5ea1 | 140 | c.47.1.2 (A:365-504) Protein disulfide isomerase, | 4e-15 | |
| d2djja1 | 116 | c.47.1.2 (A:6-121) Protein disulfide isomerase, PD | 2e-20 | |
| d2djja1 | 116 | c.47.1.2 (A:6-121) Protein disulfide isomerase, PD | 3e-14 | |
| d2djka1 | 133 | c.47.1.2 (A:1-133) Protein disulfide isomerase, PD | 1e-19 | |
| d1a8ya1 | 124 | c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola | 2e-18 | |
| d1a8ya1 | 124 | c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola | 4e-17 | |
| d2b5ea4 | 119 | c.47.1.2 (A:23-141) Protein disulfide isomerase, P | 1e-16 | |
| d2b5ea4 | 119 | c.47.1.2 (A:23-141) Protein disulfide isomerase, P | 7e-10 | |
| d1a8ya2 | 102 | c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Orycto | 2e-16 | |
| d2es7a1 | 119 | c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H | 2e-16 | |
| d2es7a1 | 119 | c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H | 2e-14 | |
| d2trxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId | 9e-16 | |
| d2trxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId | 4e-14 | |
| d1nhoa_ | 85 | c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik | 2e-15 | |
| d1nhoa_ | 85 | c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik | 1e-13 | |
| d2hfda1 | 132 | c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H | 3e-15 | |
| d2hfda1 | 132 | c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H | 3e-15 | |
| d2b5ea3 | 125 | c.47.1.2 (A:240-364) Protein disulfide isomerase, | 2e-13 | |
| d1nw2a_ | 105 | c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc | 2e-13 | |
| d1nw2a_ | 105 | c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc | 1e-11 | |
| d1dbya_ | 107 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 4e-13 | |
| d1dbya_ | 107 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 3e-11 | |
| d1thxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 | 9e-13 | |
| d1thxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 | 1e-12 | |
| d1f9ma_ | 112 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 3e-11 | |
| d1f9ma_ | 112 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 2e-08 | |
| d1zmaa1 | 115 | c.47.1.1 (A:1-115) Bacterocin transport accessory | 3e-11 | |
| d1zmaa1 | 115 | c.47.1.1 (A:1-115) Bacterocin transport accessory | 1e-07 | |
| d1fb6a_ | 104 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 1e-10 | |
| d1fb6a_ | 104 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 2e-08 | |
| d1fo5a_ | 85 | c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik | 4e-10 | |
| d1fo5a_ | 85 | c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik | 1e-09 | |
| d1a8la2 | 107 | c.47.1.2 (A:120-226) Protein disulfide isomerase, | 5e-10 | |
| d1a8la2 | 107 | c.47.1.2 (A:120-226) Protein disulfide isomerase, | 3e-09 | |
| d1syra_ | 103 | c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas | 3e-09 | |
| d1syra_ | 103 | c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas | 4e-07 | |
| d1ti3a_ | 113 | c.47.1.1 (A:) Thioredoxin {European aspen (Populus | 4e-09 | |
| d1ti3a_ | 113 | c.47.1.1 (A:) Thioredoxin {European aspen (Populus | 1e-08 | |
| d1hyua4 | 96 | c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase | 4e-09 | |
| d1hyua4 | 96 | c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase | 3e-06 | |
| d1gh2a_ | 107 | c.47.1.1 (A:) Thioredoxin-like protein, N-terminal | 5e-09 | |
| d1gh2a_ | 107 | c.47.1.1 (A:) Thioredoxin-like protein, N-terminal | 2e-06 | |
| d2ifqa1 | 105 | c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien | 6e-09 | |
| d2ifqa1 | 105 | c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien | 9e-07 | |
| d2fwha1 | 117 | c.47.1.1 (A:428-544) Thiol:disulfide interchange p | 4e-08 | |
| d2fwha1 | 117 | c.47.1.1 (A:428-544) Thiol:disulfide interchange p | 2e-07 | |
| d1sena_ | 135 | c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 | 4e-08 | |
| d1sena_ | 135 | c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 | 9e-07 | |
| d2fy6a1 | 143 | c.47.1.10 (A:33-175) Peptide methionine sulfoxide | 6e-08 | |
| d2fy6a1 | 143 | c.47.1.10 (A:33-175) Peptide methionine sulfoxide | 1e-06 | |
| d1qgva_ | 137 | c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human | 2e-07 | |
| d1qgva_ | 137 | c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human | 3e-07 | |
| d1woua_ | 119 | c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxi | 2e-07 | |
| d1woua_ | 119 | c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxi | 1e-05 | |
| d1xfla_ | 114 | c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi | 4e-07 | |
| d1xfla_ | 114 | c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi | 1e-06 | |
| d1wjka_ | 100 | c.47.1.1 (A:) Thioredoxin-like structure containin | 4e-07 | |
| d1wjka_ | 100 | c.47.1.1 (A:) Thioredoxin-like structure containin | 4e-04 | |
| d1r26a_ | 113 | c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax | 4e-07 | |
| d1r26a_ | 113 | c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax | 3e-05 | |
| d1ep7a_ | 112 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 6e-07 | |
| d1ep7a_ | 112 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 6e-06 | |
| d2trcp_ | 217 | c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ | 6e-07 | |
| d2trcp_ | 217 | c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ | 7e-07 | |
| d2b5xa1 | 143 | c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase | 1e-06 | |
| d2b5xa1 | 143 | c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase | 4e-06 | |
| d1xwaa_ | 111 | c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m | 8e-06 | |
| d1xwaa_ | 111 | c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m | 8e-05 | |
| d1z6na1 | 166 | c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps | 8e-05 | |
| d1z5ye1 | 136 | c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG | 5e-04 | |
| d1z5ye1 | 136 | c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG | 0.002 | |
| d1i5ga_ | 144 | c.47.1.10 (A:) Tryparedoxin II {Crithidia fascicul | 0.001 | |
| d1lu4a_ | 134 | c.47.1.10 (A:) Soluble secreted antigen MPT53 {Myc | 0.002 |
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: ERP29 N domain-like domain: Windbeutel, N-terminal domain species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 110 bits (277), Expect = 8e-30
Identities = 20/117 (17%), Positives = 40/117 (34%), Gaps = 9/117 (7%)
Query: 33 VLTLDHSNFSDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASELSSHDPPVVLAKVDA- 91
+ LD +F TV + + VV+F K + + +++A V
Sbjct: 4 CVDLDELSFEKTVERFPYSVVKFDIASPYGEKH--EAFTAFSKSAHKATKDLLIATVGVK 61
Query: 92 --NEEANKELASQYE--IRGFPTIKILRNGGKTIQ--EYKGPREADGIVEYLKKQSG 142
E NK L +Y+ + FP+I + + D + ++ +
Sbjct: 62 DYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTP 118
|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 102 | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 125 | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Length = 117 | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Length = 117 | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.88 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.87 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.86 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.86 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.86 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.85 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.85 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.84 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.84 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.84 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.83 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.83 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.82 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.82 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.82 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.81 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.8 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.8 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.79 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.79 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.78 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.78 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.77 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.77 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.77 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.76 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.76 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.76 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.75 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.74 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.72 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.72 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.72 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.72 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.72 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.72 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.71 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.7 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.7 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.69 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.69 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.69 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.68 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.67 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.67 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.67 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.66 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.66 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.64 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.62 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.6 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.6 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.59 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.56 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.54 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.54 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.54 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.54 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.5 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.48 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.48 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.47 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.42 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.41 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 99.38 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 99.31 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.29 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 99.29 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 99.26 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 99.26 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 99.26 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 99.21 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.19 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 99.18 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 99.17 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 99.15 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 99.14 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 99.13 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 99.08 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 99.08 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 99.05 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 99.01 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 99.0 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.98 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 98.97 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 98.97 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 98.97 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 98.96 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 98.92 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.89 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.85 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 98.8 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 98.8 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 98.71 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 98.68 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 98.66 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 98.5 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 98.34 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 98.26 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 98.25 | |
| d1a8ya3 | 119 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 98.17 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 98.11 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 98.06 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 98.04 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 97.95 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 97.92 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 97.92 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 97.9 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 97.87 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 97.86 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.82 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.82 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 97.76 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 97.76 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 97.73 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 97.7 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 97.7 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 97.65 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 97.62 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 97.56 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 97.47 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 97.46 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 97.41 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 97.4 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 97.38 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 97.37 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.34 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 97.31 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 97.27 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 97.25 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 97.19 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 97.18 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.17 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 97.14 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 97.14 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 97.13 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 97.06 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 97.02 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 96.96 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 96.96 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 96.9 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 96.89 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.86 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 96.85 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 96.83 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 96.79 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 96.78 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 96.78 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.76 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 96.67 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 96.62 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 96.53 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 96.43 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 96.4 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.33 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 96.27 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 96.25 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 96.23 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 96.17 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 96.11 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.09 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 96.03 | |
| d2b5ea2 | 98 | Protein disulfide isomerase, PDI {Baker's yeast (S | 95.85 | |
| d1xcca_ | 219 | 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax | 95.85 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 95.76 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 95.76 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 95.73 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 95.67 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 95.51 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 94.78 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 94.74 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 94.32 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 94.19 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 94.17 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 94.09 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 94.09 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 94.07 | |
| d1hyua3 | 102 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 93.27 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 92.89 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 92.69 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 92.21 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 91.78 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 91.59 | |
| d1a8ya3 | 119 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 91.1 | |
| d1t4za_ | 105 | Adaptive-response sensory-kinase SasA, N-terminal | 89.94 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 86.63 | |
| d1hd2a_ | 161 | Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 | 85.55 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 83.35 |
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: PDI-like domain: Protein disulfide isomerase, PDI species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=4.5e-23 Score=164.26 Aligned_cols=115 Identities=56% Similarity=1.022 Sum_probs=105.3
Q ss_pred cccCceEEcCccChhhhhccCCeEEEEEECCCChhhhhhhHHHHHHHHHhcCCCCCeEEEEEecChhhhHHHHHhcCccc
Q 010804 28 ESKEFVLTLDHSNFSDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASELSSHDPPVVLAKVDANEEANKELASQYEIRG 107 (500)
Q Consensus 28 ~~~~~v~~l~~~~~~~~~~~~~~~lv~f~~~~c~~C~~~~~~~~~~~~~~~~~~~~v~~~~vd~~~~~~~~~~~~~~i~~ 107 (500)
+..+.|..|++++|++++++++++||.||++||++|+.+.|.|.++++.+.+.+.++.++.|||+.... +|++|+|.+
T Consensus 4 ~~~~~V~~l~~~~f~~~l~~~k~vlV~Fya~wC~~C~~~~p~~~~~~~~~~~~~~~v~~~~vd~~~~~~--l~~~~~i~~ 81 (120)
T d1meka_ 4 EEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESD--LAQQYGVRG 81 (120)
T ss_dssp CEETTEEECCTTTHHHHHHHCSEEEEEEECSSCSTTSTTHHHHHHHHHTTTTTCCCCBCEEEETTTCCS--SHHHHTCCS
T ss_pred CCCCCeEEcCHHHHHHHHhcCCcEEEEEECCCcCCccccchhhhhhcccccccccceeeeccccccchh--HHHHhCCcc
Confidence 446779999999999999999999999999999999999999999999998777789999999999998 999999999
Q ss_pred ccEEEEEecCCc-eeeecCCCCCHHHHHHHHHhhcCCC
Q 010804 108 FPTIKILRNGGK-TIQEYKGPREADGIVEYLKKQSGPA 144 (500)
Q Consensus 108 ~P~~~~~~~~~~-~~~~~~g~~~~~~l~~~i~~~~~~~ 144 (500)
+||+++|.+|.. ....|.|.++.++|.+||+++++|+
T Consensus 82 ~Pt~~~~~~G~~~~~~~~~g~~~~~~l~~fi~~~~~p~ 119 (120)
T d1meka_ 82 YPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPA 119 (120)
T ss_dssp SSEEEEEESSCSSSCEECCCCSSHHHHHHHHHTTSCCC
T ss_pred CCeEEEEECCeEeeeEEecCCCCHHHHHHHHHHhhCCC
Confidence 999999987633 3467999999999999999999885
|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|