Citrus Sinensis ID: 010828

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MFRVASASQYLAITGTGINDVKLAKKSWVFPGQYCTVFDITPVNYDFEVQAMSAEKLEFKLPAVFTIGPREDDRDSLLKYAKLIAPKDQNSIHVREIVKGIIEGETRVLAASMTMEEVFKGTKEFKQEVFEKVQLELNQFGLLIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVDVAEARMKGEVGAKLREGQTLQNAAKIDAETKIIKVQRQGDGQKEEMRVKTEVKVFENQREAEVAEANAELAKKKAGWAREAKVAEVESTKAVALRDAELQREVEKMNAATSMEKLRAEFVSKANVEYEAQVQEANWELYKKQKEAEAILYQKEKEAEAQKATAEAAFYARKQAADGQLYTKLKEAEGLVALGKAQGEYLKSISTSLGGDYRAVKDFLMIDRGVYQEMARINAEAVRGLQPKLSIWTNNESGGEAGGDASSSAMREVSGIYRALPPLFQTIYDQTGMTPPPFMGTLAQTGMTPPQIPGTLALESSNPYNKN
cEEEccccEEEEEEccccccEEEccCEEEECcCEEEEEEEEEEEEEEEEccccccccCEEEEEEEEECcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHHHHcccEEEEEECcccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHcccccccccccccccccccccccccccc
MFRVASASQYLAITGTGINDVKLAKKSWVFPGQYCTVFDITPVNYDFEVQAMSAEKLEFKLPAVFTIGPREDDRDSLLKYAKLIAPKDQNSIHVREIVKGIIEGETRVLAASMTMEEVFKGTKEFKQEVFEKVQLELNQFGLLIYNANIKQLVDVPGHEYFSYLGQK**********************************************************************************************************************************FVSKANVEYEAQVQEANWELYKKQKEAEAILYQKEKEAEAQKATAEAAFYARKQAADGQLYTKLKEAEGLVALGKAQGEYLKSISTSLGGDYRAVKDFLMIDRGVYQEMARINAEAVRGLQPKLSIWT********************SGIYRALPPLFQTIYDQTGMTPPPF*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRVASASQYLAITGTGINDVKLAKKSWVFPGQYCTVFDITPVNYDFEVQAMSAEKLEFKLPAVFTIGPREDDRDSLLKYAKLIAPKDQNSIHVREIVKGIIEGETRVLAASMTMEEVFKGTKEFKQEVFEKVQLELNQFGLLIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVDVAEARMKGEVGAKLREGQTLQNAAKIDAETKIIKVQRQGDGQKEEMRVKTEVKVFENQREAEVAEANAELAKKKAGWAREAKVAEVESTKAVALRDAELQREVEKMNAATSMEKLRAEFVSKANVEYEAQVQEANWELYKKQKEAEAILYxxxxxxxxxxxxxxxxxxxxxQAADGQLYTKLKEAEGLVALGKAQGEYLKSISTSLGGDYRAVKDFLMIDRGVYQEMARINAEAVRGLQPKLSIWTNNESGGEAGGDASSSAMREVSGIYRALPPLFQTIYDQTGMTPPPFMGTLAQTGMTPPQIPGTLALESSNPYNKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flotillin-like protein 2 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles (By similarity). Required for early symbiotic events and nodules formation.probableD2XNQ9
Flotillin-like protein 1 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles (By similarity). May be involved in nodule formation.probableD2XNQ8
Flotillin-like protein 3 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles (By similarity). May be involved in nodule formation.probableD2XNR0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZUO, chain A
Confidence level:confident
Coverage over the Query: 3-164
View the alignment between query and template
View the model in PyMOL
Template: 3BK6, chain A
Confidence level:confident
Coverage over the Query: 33-193
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 191-221,262-365
View the alignment between query and template
View the model in PyMOL