Citrus Sinensis ID: 010841


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MWESESESLGGRDYGNGVLSSTKLSVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRWAYTGRPPKISSPKWNDMKDSSPSRSQPVPPDWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISSYSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAKMRVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKVISNFCY
ccccccccccccccccccccccccccccccccccccCEEEEccccccEEEEEccEEEEECccccccccHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccccccccccccHHHHHEEEHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccc
**********************K*SVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRW*Y****************************DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESS*****************CSSWKGG*****************KDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLV*********************************RVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKVISNFC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWESESESLGGRDYGNGVLSSTKLSVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRWAYTGRPPKISSPKWNDMKDSSPSRSQPVPPDWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISSYSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAKMRVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKVISNFCY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Root phototropism protein 3 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Signal transducer of the phototropic response and photo-induced movements. Involved in the phot1 pathway under low blue light (LBL) fluence rate and in the phot2 pathway under higher fluence rate of blue light (HBL). Necessary for root and hypocotyl phototropisms, but not for the regulation of stomata opening. Not involved in chloroplast accumulation and translocation.probableQ9FMF5
Coleoptile phototropism protein 1 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Plays a role as signal transduction component in coleoptile phototropism and lateral translocation of auxin.probableQ5KS50

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z8H, chain A
Confidence level:confident
Coverage over the Query: 32-153
View the alignment between query and template
View the model in PyMOL
Template: 3I3N, chain A
Confidence level:confident
Coverage over the Query: 34-196,230-272,322-369
View the alignment between query and template
View the model in PyMOL