Citrus Sinensis ID: 010863


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQFNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPSSSIFNTRLHQDHQFTQTTHQDLTRNDHPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATALLQKAAQMGATMSSSKASTATGNSSSSSSPAHHAALTRPHQQPPPPQQAHVSATPEHPAGNNKTKTTTGFGLNLSSREGVVHGLTPFGTKTSGGGSSGPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPHLNHSFNESSSLSRTSGINDHGEEMTRDFLGLRALSQTDILNIAGLGNCIDTRSSHEQQLNHSQKPWQG
ccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccHHHHHccccccccc
cccccEEEEEccccccHHHHHHHHcccccccccccccccccccEEEEEcccccccccccHHHHccHHHHHHHHcccccccccEccccccHEEEHccHHHHHccccccEEEcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHccccccccHHHHHHHccccccccccHHHHHHHcccccccc
MATNRFVCEICNkgfqrdqnlqlhrrghnlpwklkqRTSKEIRkkvyvcpepncvhhdpsralgdltgikkhfcrkhgekkwkcdkcskryavqsdwkahsktcgtreyrcdcgtlfsrrdsfITHRAFCDALAEEStraitgtnpilsssshhqpgivagasshvnlqipqfnpqdfsafslkKEQQSYSlrqemppwlgsqqpsilgsavpglgqppssshtvdhlsspsssifntrlhqdhqftqtthqdltrndhpanpnpslgptlsvphtnyhqAMASAFPHMSATALLQKAAQMGatmssskastatgnsssssspahhaaltrphqqppppqqahvsatpehpagnnktktttgfglnlssregvvhgltpfgtktsgggssgpFIQEMLMntsfssgyaaaspfddaltfggvfnskkephlnhsfnessslsrtsgindhgeemTRDFLGLRALSQTDIlniaglgncidtrssheqqlnhsqkpwqg
MATNRFVCEICNkgfqrdqnlqlhrrghnlpwklkqrtskEIRKKVYvcpepncvhhdpsralgdlTGIKKHFCRkhgekkwkcdkcskryavqsdwkahsktcgtreyrcDCGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQFNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPSSSIFNTRLHQDHQFTQTTHQDLTRNDHPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATALLQKAAQMGATMSSSKASTATGNSSSSSSPAHHAALTRPHQQPPPPQQAHVSATPEHPAGNNKTKTTTGFGLNLSSREGVVHGLTPFGTKTSGGGSSGPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPhlnhsfnessslsrTSGINDHGEEMTRDFLGLRALSQTDILNIAGLGNCIDTRssheqqlnhsqkpwqg
MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQFNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPSSSIFNTRlhqdhqftqtthqdltRNDHPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATALLQKAAQMGatmssskastatgnsssssspahhaaLTRPHqqppppqqAHVSATPEHPAgnnktktttgFGLNLSSREGVVHGLTPFGTKTsgggssgPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPHLNHSFNESSSLSRTSGINDHGEEMTRDFLGLRALSQTDILNIAGLGNCIDTRSSHEQQLNHSQKPWQG
****RFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTRAI***************************************************************************************************************************************************************************************************************************************VVHGL********************L****F*SGYAAASPFDDALTFGGVF*********************************DFLGLRALSQTDILNIAGLGNCID******************
MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWK************VYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTR**T*************************************************************************************************************************************************************************************************************************************************************************************************************************RDFLGLRALSQTDILNIAGLGNC********************
MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQFNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPG*****************SSSIFNTRLHQDHQFTQTTHQDLTRNDHPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATALLQK*******************************************************GNNKTKTTTGFGLNLSSREGVVHGLTPFGTKTSGGGSSGPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPHLNH***********SGINDHGEEMTRDFLGLRALSQTDILNIAGLGNCIDTR****************
**TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTR****************************************************************************************************************************************************************Q*G**************************LTRPHQQPPPPQQAHV*******AGNN*TKTTTGFGLNLSSREGVVHGLTPFGTKTSGGGSSGPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFN****************************EMTRDFLGLRALSQTDILNIAGLGNCIDT*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQFNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPSSSIFNTRLHQDHQFTQTTHQDLTRNDHPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATALLQKAAQMGATMSSSKASTATGNSSSSSSPAHHAALTRPHQQPPPPQQAHVSATPEHPAGNNKTKTTTGFGLNLSSREGVVHGLTPFGTKTSGGGSSGPFIQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPHLNHSFNESSSLSRTSGINDHGEEMTRDFLGLRALSQTDILNIAGLGNCIDTRSSHEQQLNHSQKPWQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query498 2.2.26 [Sep-21-2011]
Q9FFH3466 Zinc finger protein NUTCR no no 0.542 0.579 0.517 1e-79
Q9ZWA6506 Zinc finger protein MAGPI no no 0.317 0.312 0.796 4e-79
Q700D2503 Zinc finger protein JACKD no no 0.305 0.302 0.793 2e-75
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.345 0.344 0.312 2e-18
Q943I6522 Zinc finger protein STOP1 no no 0.365 0.348 0.283 2e-18
Q2QX40465 Zinc finger protein STAR3 no no 0.244 0.262 0.350 5e-17
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.246 0.405 0.353 1e-13
O43313 823 ATM interactor OS=Homo sa yes no 0.238 0.144 0.314 1e-11
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.232 0.141 0.315 1e-10
Q6PGE41016 Zinc finger protein 316 O no no 0.204 0.100 0.306 8e-07
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function desciption
 Score =  297 bits (761), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 166/321 (51%), Positives = 192/321 (59%), Gaps = 51/321 (15%)

Query: 1   MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPS 60
           MATNRF+CE+C KGFQRDQNLQLHRRGHNLPWKLKQRTSKE+RK+VYVCPE  CVHH  S
Sbjct: 61  MATNRFLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHSS 120

Query: 61  RALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRR 120
           RALGDLTGIKKHFCRKHGEKKW C+KC+KRYAVQSDWKAHSKTCGTREYRCDCGT+FSRR
Sbjct: 121 RALGDLTGIKKHFCRKHGEKKWTCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRR 180

Query: 121 DSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQ--------IPQ 172
           DSFITHRAFCDALAEE+ +        +++ SH      AGA   VNL         IP 
Sbjct: 181 DSFITHRAFCDALAEETAK--------INAVSHLNGLAAAGAPGSVNLNYQYLMGTFIPP 232

Query: 173 FNPQDFSAFSLKKEQQSYSLRQEMPPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPS 232
             P     F  + +       Q   P   S     +G  +      P       +  + S
Sbjct: 233 LQP-----FVPQPQTNPNHHHQHFQPPTSSSLSLWMGQDIAPPQPQPDYDWVFGNAKAAS 287

Query: 233 SSIFNTRLHQDHQFTQTTHQ-----------DLTRNDHPANPNPSLGPTLSVPHTNYHQA 281
           + I N   H D Q TQ  +             L  +D P N N                 
Sbjct: 288 ACIDNNNTH-DEQITQNANASLTTTTTLSAPSLFSSDQPQNAN----------------- 329

Query: 282 MASAFPHMSATALLQKAAQMG 302
            A++  +MSATALLQKAA++G
Sbjct: 330 -ANSNVNMSATALLQKAAEIG 349




Putative transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
359482846509 PREDICTED: zinc finger protein NUTCRACKE 0.861 0.842 0.567 1e-133
147854387532 hypothetical protein VITISV_006257 [Viti 0.861 0.806 0.567 1e-133
255572931552 nucleic acid binding protein, putative [ 0.905 0.817 0.567 1e-125
356528841524 PREDICTED: zinc finger protein NUTCRACKE 0.833 0.791 0.534 1e-123
356522186498 PREDICTED: zinc finger protein NUTCRACKE 0.785 0.785 0.524 1e-120
359475946509 PREDICTED: zinc finger protein NUTCRACKE 0.845 0.827 0.500 1e-112
87162706480 Zinc finger, C2H2-type [Medicago truncat 0.783 0.812 0.496 1e-111
357454633545 Zinc finger protein [Medicago truncatula 0.783 0.715 0.496 1e-111
302398661539 C2H2L domain class transcription factor 0.869 0.803 0.518 1e-111
302398675523 C2H2L domain class transcription factor 0.869 0.827 0.518 1e-111
>gi|359482846|ref|XP_002280155.2| PREDICTED: zinc finger protein NUTCRACKER isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 301/530 (56%), Positives = 347/530 (65%), Gaps = 101/530 (19%)

Query: 1   MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPS 60
           MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKE+RKKVYVCPE +CVHHDPS
Sbjct: 49  MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKKVYVCPEASCVHHDPS 108

Query: 61  RALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRR 120
           RALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRR
Sbjct: 109 RALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRR 168

Query: 121 DSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVAGASSHVNLQIPQ---FNPQ- 176
           DSFITHRAFCDALAEES RAITG NP+L SS        +   SH  + + Q   FN   
Sbjct: 169 DSFITHRAFCDALAEESARAITG-NPVLLSSQAAAGPSSSTPHSHSQMSLQQQQQFNSNH 227

Query: 177 DFSAFSLKKEQQSYSLRQEM-PPWLGSQQPSILGSAVPGLGQPPSSSHTVDHLSSPSSSI 235
           DF AF +KKEQQS+S+R E+ PPW                              S SSS+
Sbjct: 228 DFHAFQMKKEQQSFSIRSEVVPPW-----------------------------LSSSSSL 258

Query: 236 FNTRLHQDHQFTQTTHQDLTRND-HPANPNPSLGPTLSVPHTNYHQAMASAFPHMSATAL 294
           F TRL  DH FTQTT QDL  +D    NPNPSLGPTL      YH  ++   PHMSATAL
Sbjct: 259 FPTRL--DHDFTQTT-QDLALHDIQNPNPNPSLGPTLPP----YHPTLS---PHMSATAL 308

Query: 295 LQKAAQMGATMSSSKASTATGNSSSSSSPAHHAALTRPHQQPPPPQQAHVSATPEHPAGN 354
           LQKAAQMGATMS +     TG S +S       A+ RPHQ       AHVSA  +H   N
Sbjct: 309 LQKAAQMGATMSKT-----TGGSGASP-----PAMIRPHQ-------AHVSA--DHSCNN 349

Query: 355 NKTKTTTGFGLNLSSRE----GVVHGLTPFGTKTSGGG-----------------SSGPF 393
                TTGFGLNLSSRE    G V GL PFG K +                    S    
Sbjct: 350 -----TTGFGLNLSSREEMGGGFVQGLAPFGNKAAAVPSAAAAAAAATGPGGGAPSPSLL 404

Query: 394 IQEMLMNTSFSSGYAAASPFDDALTFGGVFNSKKEPH-LNHSFNESSSLSRTSGINDHG- 451
           +Q+M+ + S ++G+ ++S F+DA  FGG+ NS+K  + L+ +    S+ +  +  +  G 
Sbjct: 405 LQDMMTSLSSATGFDSSS-FEDA--FGGMLNSRKNGNNLHQTLPSKSTTTTATTHHSSGG 461

Query: 452 ---EEMTRDFLGLRALSQTDILNIAGLGNCIDTRSSHEQQLNHSQKPWQG 498
              + +TRDFLGLRALS +DIL+IAGLG C++T S H+ Q N +QKPWQG
Sbjct: 462 AGNDGLTRDFLGLRALSHSDILSIAGLGTCMNT-SPHDHQ-NQTQKPWQG 509




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147854387|emb|CAN79105.1| hypothetical protein VITISV_006257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572931|ref|XP_002527396.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533206|gb|EEF34962.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356528841|ref|XP_003533006.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|356522186|ref|XP_003529728.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|359475946|ref|XP_002278933.2| PREDICTED: zinc finger protein NUTCRACKER-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|87162706|gb|ABD28501.1| Zinc finger, C2H2-type [Medicago truncatula] Back     alignment and taxonomy information
>gi|357454633|ref|XP_003597597.1| Zinc finger protein [Medicago truncatula] gi|355486645|gb|AES67848.1| Zinc finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|302398661|gb|ADL36625.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398675|gb|ADL36632.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
TAIR|locus:2051698602 IDD5 "AT2G02070" [Arabidopsis 0.307 0.254 0.826 3.2e-88
TAIR|locus:2205672455 IDD7 "AT1G55110" [Arabidopsis 0.453 0.496 0.634 1.7e-86
TAIR|locus:2173624500 IDD1 "AT5G66730" [Arabidopsis 0.279 0.278 0.899 1.2e-81
TAIR|locus:2024193506 MGP "AT1G03840" [Arabidopsis t 0.317 0.312 0.796 2.5e-81
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.453 0.5 0.595 4.1e-79
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.309 0.383 0.793 3e-75
TAIR|locus:2143543503 JKD "AT5G03150" [Arabidopsis t 0.582 0.576 0.509 3.2e-75
TAIR|locus:2078262446 AT3G45260 "AT3G45260" [Arabido 0.594 0.663 0.517 4.5e-75
TAIR|locus:2051688516 IDD4 "indeterminate(ID)-domain 0.598 0.577 0.493 3.1e-74
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.572 0.611 0.522 5.1e-74
TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 746 (267.7 bits), Expect = 3.2e-88, Sum P(4) = 3.2e-88
 Identities = 129/156 (82%), Positives = 144/156 (92%)

Query:     1 MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPS 60
             MATNRF+CE+CNKGFQR+QNLQLHRRGHNLPWKLKQ+++KE+++KVY+CPEP+CVHHDPS
Sbjct:    76 MATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKEVKRKVYLCPEPSCVHHDPS 135

Query:    61 RALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRR 120
             RALGDLTGIKKH+ RKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGT+EYRCDCGTLFSRR
Sbjct:   136 RALGDLTGIKKHYYRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTKEYRCDCGTLFSRR 195

Query:   121 DSFITHRAFCDALAEESTRAITGTNPILSSSSHHQP 156
             DSFITHRAFCDALA+ES R  T    + S  SHH P
Sbjct:   196 DSFITHRAFCDALAQESARHPTS---LTSLPSHHFP 228


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0006417 "regulation of translation" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 498
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.9
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.86
KOG3576267 consensus Ovo and related transcription factors [T 99.67
KOG3608467 consensus Zn finger proteins [General function pre 99.67
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.58
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.58
KOG3576267 consensus Ovo and related transcription factors [T 99.51
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.44
KOG3608467 consensus Zn finger proteins [General function pre 99.42
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.36
PLN03086567 PRLI-interacting factor K; Provisional 99.12
PLN03086567 PRLI-interacting factor K; Provisional 98.93
PHA00733128 hypothetical protein 98.82
PHA00733128 hypothetical protein 98.81
KOG3993500 consensus Transcription factor (contains Zn finger 98.69
PHA0276855 hypothetical protein; Provisional 98.37
PHA0276855 hypothetical protein; Provisional 98.3
KOG3993500 consensus Transcription factor (contains Zn finger 98.17
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.16
PHA0073279 hypothetical protein 97.71
PHA0061644 hypothetical protein 97.7
COG5189423 SFP1 Putative transcriptional repressor regulating 97.63
COG5189423 SFP1 Putative transcriptional repressor regulating 97.57
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.4
PHA0061644 hypothetical protein 97.39
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.39
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.37
PHA0073279 hypothetical protein 97.35
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.1
KOG1146 1406 consensus Homeobox protein [General function predi 96.99
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.97
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.84
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.76
KOG2231669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.72
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.6
COG5048467 FOG: Zn-finger [General function prediction only] 96.55
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.32
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.06
smart0035526 ZnF_C2H2 zinc finger. 95.95
KOG1146 1406 consensus Homeobox protein [General function predi 95.74
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.67
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.98
PRK04860160 hypothetical protein; Provisional 94.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.66
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.27
PRK04860160 hypothetical protein; Provisional 93.88
smart0035526 ZnF_C2H2 zinc finger. 93.72
COG5236493 Uncharacterized conserved protein, contains RING Z 93.62
COG5048467 FOG: Zn-finger [General function prediction only] 92.5
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.47
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.44
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 92.11
KOG2231669 consensus Predicted E3 ubiquitin ligase [Posttrans 91.72
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 91.7
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 90.63
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 90.23
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 88.64
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 85.41
COG5236493 Uncharacterized conserved protein, contains RING Z 84.47
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 84.11
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 83.82
KOG2893341 consensus Zn finger protein [General function pred 82.83
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 82.07
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 81.9
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 81.4
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 80.63
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.90  E-value=1e-24  Score=213.10  Aligned_cols=135  Identities=19%  Similarity=0.407  Sum_probs=125.2

Q ss_pred             CCccccCccCcccCChHHHHHHHHhcCCCccccccccccccCcceeCCCCCCCCCCCCCccCChhhHhhhhhhccCCccc
Q 010863            3 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRKHGEKKW   82 (498)
Q Consensus         3 ekpy~C~~CgK~F~~~s~L~~H~r~H~~p~~c~~~~~~~~~~k~y~C~~C~C~~~~~~k~F~~~s~Lk~H~r~Htgekp~   82 (498)
                      ..+|+|.+|||.|.+.++|.+|+.+|..          ....+.+.|++|       +|.|.+...|+.|+++|+  -++
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~----------~~s~ka~~C~~C-------~K~YvSmpALkMHirTH~--l~c  188 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRS----------LDSKKAFSCKYC-------GKVYVSMPALKMHIRTHT--LPC  188 (279)
T ss_pred             CCceeccccccccccccccchhhccccc----------ccccccccCCCC-------CceeeehHHHhhHhhccC--CCc
Confidence            4579999999999999999999999961          114788999999       999999999999999998  579


Q ss_pred             ccCcCCccccchhHHHHHHhh-hCCCceecC-CCCccCChHHHHHHHHHhhhccccccccccCCCCCCCCCCCCCCCCCC
Q 010863           83 KCDKCSKRYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRRDSFITHRAFCDALAEESTRAITGTNPILSSSSHHQPGIVA  160 (498)
Q Consensus        83 ~C~~CgK~F~~~s~L~~H~r~-hgekpy~C~-Cgk~F~~~s~L~~H~~~h~~~~~~s~r~h~~~kp~~C~~C~~sf~~~s  160 (498)
                      +|.+|||.|.+.+.|+-|+|+ +|||||.|. |+|.|..+++|+.|+           .+|.+.|+|.|..|+|+|...+
T Consensus       189 ~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm-----------QTHS~~K~~qC~~C~KsFsl~S  257 (279)
T KOG2462|consen  189 ECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM-----------QTHSDVKKHQCPRCGKSFALKS  257 (279)
T ss_pred             ccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHH-----------HhhcCCccccCcchhhHHHHHH
Confidence            999999999999999999999 899999999 999999999999999           7888899999999999999999


Q ss_pred             ccccccc
Q 010863          161 GASSHVN  167 (498)
Q Consensus       161 ~l~sH~~  167 (498)
                      -|+.|.-
T Consensus       258 yLnKH~E  264 (279)
T KOG2462|consen  258 YLNKHSE  264 (279)
T ss_pred             HHHHhhh
Confidence            9988864



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 22/124 (17%) Query: 6 FVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGD 65 + C C K F + NL+ H+R H +K Y CPE ++ Sbjct: 78 YKCPECGKSFSQRANLRAHQRTH-------------TGEKPYACPECG-------KSFSQ 117 Query: 66 LTGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKT-CGTREYRC-DCGTLFSRRDSF 123 L ++ H GEK +KC +C K ++ + + H +T G + Y+C +CG FSRRD+ Sbjct: 118 LAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDAL 177 Query: 124 ITHR 127 H+ Sbjct: 178 NVHQ 181
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-04
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
 Score = 50.6 bits (122), Expect = 5e-08
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 26/128 (20%)

Query: 6   FVCE--ICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRAL 63
           F+C    CNK + +  +LQ+H R H          + E   K Y C   +C      R  
Sbjct: 7   FMCAYPGCNKRYFKLSHLQMHSRKH----------TGE---KPYQCDFKDC-----ERRF 48

Query: 64  GDLTGIKKHFCRKH-GEKKWKCDKCSKRYAVQSDWKAHSKT-CGTREYRC---DCGTLFS 118
                +K+H  R+H G K ++C  C ++++     K H++T  G + + C    C   F+
Sbjct: 49  SRSDQLKRHQ-RRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFA 107

Query: 119 RRDSFITH 126
           R D  + H
Sbjct: 108 RSDELVRH 115


>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.92
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.8
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.79
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.78
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.78
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.69
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.68
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.67
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.66
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.65
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.64
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.63
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.63
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.62
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.61
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.59
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.56
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.55
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.49
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.47
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.43
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.42
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.41
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.4
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.38
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.31
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.29
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.29
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.28
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.27
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.27
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.27
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.24
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.23
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.23
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.22
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.22
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.19
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.02
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.92
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.92
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.91
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.9
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.89
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.88
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.88
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.87
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.85
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.85
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.83
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.8
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.8
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.8
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.8
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.79
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.78
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.78
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.78
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.78
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.76
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.75
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.75
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.75
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.75
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.74
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.73
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.73
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.72
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.72
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.71
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.69
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.69
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.67
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.67
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.6
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.6
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.59
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.59
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.59
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.59
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.59
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.58
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.58
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.58
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.58
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.58
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.58
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.57
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.57
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.57
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.57
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.56
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.56
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.56
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.55
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.55
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.54
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.53
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.52
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.52
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.52
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.51
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.51
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.51
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.51
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.51
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.5
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.5
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.5
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.48
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.48
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.48
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.47
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.47
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.46
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.44
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.41
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.4
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.39
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.37
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.31
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.28
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.14
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.13
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.08
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.05
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.02
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.99
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.97
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.93
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.92
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.92
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.9
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.9
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.89
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.89
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.85
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.84
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.82
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.82
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.81
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.81
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.79
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.77
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.77
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.76
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.95
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.75
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.91
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.72
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.72
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.71
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.71
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.68
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.83
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.64
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.63
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.58
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.57
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.52
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.49
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.42
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.38
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.38
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.33
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.32
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.31
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.31
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.29
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.23
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.3
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.29
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.14
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.14
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.1
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.09
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.09
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.8
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.76
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.47
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.38
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.27
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.81
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.75
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.74
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.15
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.86
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.0
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.72
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.92  E-value=4.7e-26  Score=212.55  Aligned_cols=151  Identities=28%  Similarity=0.591  Sum_probs=115.8

Q ss_pred             CCCccccCccCcccCChHHHHHHHHhcC--CCccccc-------------cccccccCcceeCCCCCCCCCCCCCccCCh
Q 010863            2 ATNRFVCEICNKGFQRDQNLQLHRRGHN--LPWKLKQ-------------RTSKEIRKKVYVCPEPNCVHHDPSRALGDL   66 (498)
Q Consensus         2 gekpy~C~~CgK~F~~~s~L~~H~r~H~--~p~~c~~-------------~~~~~~~~k~y~C~~C~C~~~~~~k~F~~~   66 (498)
                      ++++|+|++|++.|.....|..|+++|.  .++.|..             +...+.++++|.|++|       ++.|...
T Consensus        18 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C-------~~~f~~~   90 (190)
T 2i13_A           18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPEC-------GKSFSQR   90 (190)
T ss_dssp             -------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTT-------CCEESCH
T ss_pred             CCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCccc-------CCccCCH
Confidence            5678888888888888888888888886  4555543             2334457788999998       8999999


Q ss_pred             hhHhhhhhhccCCcccccCcCCccccchhHHHHHHhh-hCCCceecC-CCCccCChHHHHHHHHHhhhccccccccccCC
Q 010863           67 TGIKKHFCRKHGEKKWKCDKCSKRYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRRDSFITHRAFCDALAEESTRAITGT  144 (498)
Q Consensus        67 s~Lk~H~r~Htgekp~~C~~CgK~F~~~s~L~~H~r~-hgekpy~C~-Cgk~F~~~s~L~~H~~~h~~~~~~s~r~h~~~  144 (498)
                      ..|..|++.|+++++|.|++|++.|.....|..|+++ +++++|.|+ |++.|..+..|.+|+           ++|.++
T Consensus        91 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~-----------~~H~~~  159 (190)
T 2i13_A           91 ANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ-----------RTHTGE  159 (190)
T ss_dssp             HHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHH-----------HHHHCC
T ss_pred             HHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHH-----------HhcCCC
Confidence            9999999999999999999999999999999999988 788899999 999999999999998           556678


Q ss_pred             CCCCCCCCCCCCCCCCcccccccccC
Q 010863          145 NPILSSSSHHQPGIVAGASSHVNLQI  170 (498)
Q Consensus       145 kp~~C~~C~~sf~~~s~l~sH~~~~~  170 (498)
                      ++|.|..|++.|.....|..|++.|.
T Consensus       160 ~~~~C~~C~~~f~~~~~L~~H~~~H~  185 (190)
T 2i13_A          160 KPYKCPECGKSFSRRDALNVHQRTHT  185 (190)
T ss_dssp             CCEECTTTCCEESSHHHHHHHHTTC-
T ss_pred             CCeECCCCCCccCCHHHHHHHHHhcC
Confidence            99999999999999999999988774



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.38
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.34
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.79
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.75
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.72
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.69
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.66
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.62
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.6
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.57
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.56
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.54
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.53
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.51
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.49
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.47
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.43
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.42
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.36
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.32
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.22
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.18
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.11
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.1
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.1
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.09
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.02
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.02
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.98
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.89
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.88
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.69
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.57
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.44
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.11
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.06
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.94
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.74
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.66
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.62
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.55
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.54
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.45
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.36
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.29
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.28
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.1
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.02
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.0
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.99
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.91
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.54
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.52
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.46
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.35
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.3
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.24
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.2
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.16
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.96
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.75
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.37
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.24
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.12
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.09
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.0
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.66
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 93.59
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.59
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.56
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 93.49
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.95
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.74
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 92.01
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.89
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.65
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.56
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.82
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.38
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.53
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 88.66
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.15
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 86.93
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.71
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 84.25
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 82.78
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.38  E-value=1.1e-13  Score=102.32  Aligned_cols=53  Identities=17%  Similarity=0.295  Sum_probs=34.1

Q ss_pred             CCccccCccCcccCChHHHHHHHHhcCCCccccccccccccCcceeCCCCCCCCCCCCCccCChhhHhhhhhhc
Q 010863            3 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRKKVYVCPEPNCVHHDPSRALGDLTGIKKHFCRK   76 (498)
Q Consensus         3 ekpy~C~~CgK~F~~~s~L~~H~r~H~~p~~c~~~~~~~~~~k~y~C~~C~C~~~~~~k~F~~~s~Lk~H~r~H   76 (498)
                      ||||+|+ |||.|..+..|..|+++|.             ++++|.|.+|       ++.|.....|.+|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht-------------~ekpy~C~~C-------~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHL-------------GLRPYGCGVC-------GKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHS-------------CCCSEECTTT-------SCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccc-------------cccCCcCCCc-------CCEecCHHHHHHHHhcC
Confidence            5666663 6666666666666666666             6666666666       66666666666666654



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure