Citrus Sinensis ID: 010883

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50

MKDEEALRSCIASGVDFDEMGYAMSRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLSPDQRHLVYASMSPIVHIVDVGSGTMESLANVTEIHDGLDFSAADDGGYSFGIFSLKFSTDGRELVAGSSDDCIYVYDLEANKLSLRILAHTSDVNTVCFGDESGHLIYSGSDDNLCKVWDRRCLNVKGKPAGVLMGHLEGITFIDSRGDGRYLISNGKDQAIKLWDIRKMSSNASCNLGFRSYEWDYRWMDYPPQARDLKHPCDQSVATYKGHSVLRTLIRCHFSPVYSTGQKYIYTGSHDSCVYVYDLVSGEQVAALKYHTSPVRDCSWHPSQPMLVSSSWDGDVVRWEFPGNGEAAPPLNKKRIRRRQFYL

cccHHHHEEEEEEcccccEEEEEccccEEEECcccccccEEEEECcccccccccccccccEEEEEcccccccccccECcccccccCEEEEEEEccCEEECcccccEEEEcccccEEEECcccccccECcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEccccccCEEEEEEcccccEEEEECccccEEEEEcccccEEEEEccccccccccccccccccccccEEEEEEcccccEEEEECcccEEEEEEccccEEEEEEccccccEEEEEEccccccEEEEECcccEEEEEEccccccccCEEEEcccccccEEEEEEcccccEEEECcccccEEEccccccccccccccccccccccEEEEEEcccccEEEccccccEEEEEcccEEEEcccCEEEEEEcccccEEEEECccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEECccccEEEEccccccccccccccccEEEEEEEc

*****AL*SCIASGVDFDEMGYAMSRFEIESEFYDAADTVNQASNSRSK**KP*SALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLSPDQRHLVYASMSPIVHIVDVGSGTMESLANVTEIHDGLDFSAADDGGYSFGIFSLKFSTDGRELVAGSSDDCIYVYDLEANKLSLRILAHTSDVNTVCFGDESGHLIYSGSDDNLCKVWDRRCLNVKGKPAGVLMGHLEGITFIDSRGDGRYLISNGKDQAIKLWDIRKMSSNASCNLGFRSYEWDYRWMDYPPQARDLKHPCDQSVATYKGHSVLRTLIRCHFSPVYSTGQKYIYTGSHDSCVYVYDLVSGEQVAALKYHTSPVRDCSWHPSQPMLVSSSWDGDVVRWEFPGNGEAAPPLNKKRIRRRQFYL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LEC14B homolog		probable	O24467
LEC14B protein		probable	Q40153

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GOT, chain B
Confidence level:very confident
Coverage over the Query: 123-218,229-355,390-475
View the alignment between query and template
View the model in PyMOL

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 124-215,232-482
View the alignment between query and template
View the model in PyMOL

Template: 4A11, chain B
Confidence level:very confident
Coverage over the Query: 108-216,234-366,396-478
View the alignment between query and template
View the model in PyMOL