Citrus Sinensis ID: 010962
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 496 | ||||||
| 61808337 | 640 | putative sterol esterification protein [ | 0.949 | 0.735 | 0.976 | 0.0 | |
| 225438033 | 633 | PREDICTED: phospholipid--sterol O-acyltr | 0.905 | 0.709 | 0.844 | 0.0 | |
| 255571244 | 638 | phosphatidylcholine acyltransferase, put | 0.927 | 0.721 | 0.809 | 0.0 | |
| 356570658 | 630 | PREDICTED: phospholipid--sterol O-acyltr | 0.919 | 0.723 | 0.820 | 0.0 | |
| 25992001 | 632 | lecithine cholesterol acyltransferase-li | 0.921 | 0.723 | 0.812 | 0.0 | |
| 356505046 | 632 | PREDICTED: phospholipid--sterol O-acyltr | 0.875 | 0.686 | 0.845 | 0.0 | |
| 357510087 | 712 | Phosphatidylcholine-sterol acyltransfera | 0.913 | 0.636 | 0.802 | 0.0 | |
| 147789657 | 626 | hypothetical protein VITISV_006259 [Viti | 0.891 | 0.706 | 0.828 | 0.0 | |
| 449468568 | 645 | PREDICTED: phospholipid--sterol O-acyltr | 0.915 | 0.703 | 0.787 | 0.0 | |
| 145335059 | 633 | phospholipid sterol acyl transferase 1 [ | 0.917 | 0.718 | 0.753 | 0.0 |
| >gi|61808337|gb|AAX56094.1| putative sterol esterification protein [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 933 bits (2411), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 460/471 (97%), Positives = 466/471 (98%)
Query: 1 MQMMVPTRRFAVVLVLLLVVLLGVLRDASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSI 60
MQM VPTRRFAVVL+L++VVLLG LR+ASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSI
Sbjct: 1 MQMTVPTRRFAVVLLLVVVVLLGALREASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSI 60
Query: 61 LDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITE 120
LDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITE
Sbjct: 61 LDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITE 120
Query: 121 LDPGYITGPLSSVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFE 180
LDPGYITGPLSSVWKEWVKWC+EFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFE
Sbjct: 121 LDPGYITGPLSSVWKEWVKWCVEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFE 180
Query: 181 TALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGAT 240
TALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGAT
Sbjct: 181 TALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGAT 240
Query: 241 QSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHH 300
QSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHH
Sbjct: 241 QSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHH 300
Query: 301 IHQCDEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSVSEVAHNNFSSIECGLPTQLSFSA 360
IHQCDEQEFRSNYSGWPTNLINIEIPSIR LEAYPSVSEVAHNNFSSIECGLPTQLSFSA
Sbjct: 301 IHQCDEQEFRSNYSGWPTNLINIEIPSIRELEAYPSVSEVAHNNFSSIECGLPTQLSFSA 360
Query: 361 REISDGTFFKAIEDYDPESKRLLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKT 420
REISDGTFFK+IEDYDPESKR LHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKT
Sbjct: 361 REISDGTFFKSIEDYDPESKRPLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKT 420
Query: 421 EVGYYFAPSGKPYPDNWIITDVIYEIEGSLFSRSGNLVEGNPGPTSGDETV 471
EVGYYFAPSGKPYPDNWIIT VIYEIEGSLFSRSGNLVEGNPGPTSGDETV
Sbjct: 421 EVGYYFAPSGKPYPDNWIITGVIYEIEGSLFSRSGNLVEGNPGPTSGDETV 471
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225438033|ref|XP_002271509.1| PREDICTED: phospholipid--sterol O-acyltransferase [Vitis vinifera] gi|297744188|emb|CBI37158.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255571244|ref|XP_002526572.1| phosphatidylcholine acyltransferase, putative [Ricinus communis] gi|223534133|gb|EEF35850.1| phosphatidylcholine acyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356570658|ref|XP_003553502.1| PREDICTED: phospholipid--sterol O-acyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|25992001|gb|AAN77002.1| lecithine cholesterol acyltransferase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356505046|ref|XP_003521303.1| PREDICTED: phospholipid--sterol O-acyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357510087|ref|XP_003625332.1| Phosphatidylcholine-sterol acyltransferase [Medicago truncatula] gi|355500347|gb|AES81550.1| Phosphatidylcholine-sterol acyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147789657|emb|CAN69584.1| hypothetical protein VITISV_006259 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449468568|ref|XP_004151993.1| PREDICTED: phospholipid--sterol O-acyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145335059|ref|NP_171897.2| phospholipid sterol acyl transferase 1 [Arabidopsis thaliana] gi|308191549|sp|Q4VCM1.2|LCAT2_ARATH RecName: Full=Phospholipid--sterol O-acyltransferase; AltName: Full=Lecithin-cholesterol acyltransferase-like 2 gi|332189524|gb|AEE27645.1| phospholipid sterol acyl transferase 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 496 | ||||||
| TAIR|locus:2024117 | 633 | PSAT1 "AT1G04010" [Arabidopsis | 0.885 | 0.693 | 0.772 | 4.1e-200 | |
| POMBASE|SPBC776.14 | 632 | plh1 "phospholipid-diacylglyce | 0.415 | 0.325 | 0.310 | 3.8e-25 | |
| UNIPROTKB|G4N7N1 | 638 | MGG_03560 "Phospholipid:diacyl | 0.401 | 0.311 | 0.310 | 1.7e-22 | |
| SGD|S000005291 | 661 | LRO1 "Acyltransferase that cat | 0.431 | 0.323 | 0.304 | 1.8e-21 | |
| CGD|CAL0005049 | 706 | LRO1 [Candida albicans (taxid: | 0.411 | 0.288 | 0.312 | 2.1e-21 | |
| UNIPROTKB|Q8WMP9 | 407 | PLA2G15 "Group XV phospholipas | 0.435 | 0.530 | 0.310 | 9.6e-16 | |
| UNIPROTKB|Q6XPZ3 | 408 | PLA2G15 "Group XV phospholipas | 0.423 | 0.514 | 0.291 | 1.1e-15 | |
| ZFIN|ZDB-GENE-010716-3 | 425 | lcat "lecithin-cholesterol acy | 0.570 | 0.665 | 0.268 | 1.8e-15 | |
| TAIR|locus:2173244 | 671 | PDAT "AT5G13640" [Arabidopsis | 0.417 | 0.308 | 0.280 | 5.1e-15 | |
| ZFIN|ZDB-GENE-030131-6948 | 469 | pla2g15 "phospholipase A2, gro | 0.439 | 0.464 | 0.284 | 9.5e-15 |
| TAIR|locus:2024117 PSAT1 "AT1G04010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1937 (686.9 bits), Expect = 4.1e-200, P = 4.1e-200
Identities = 346/448 (77%), Positives = 392/448 (87%)
Query: 34 EFTGDYPKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKC 93
EF GDY KLSGIIIPGFASTQLRAWSILDCPY+PLDFNPLDLVWLDTTKLLSAVNCW KC
Sbjct: 33 EFHGDYSKLSGIIIPGFASTQLRAWSILDCPYTPLDFNPLDLVWLDTTKLLSAVNCWFKC 92
Query: 94 MTLDPYNQTDNPECKSRPDSGLSAITELDPGYITGPLSSVWKEWVKWCIEFGIEANSIIA 153
M LDPYNQTD+PECKSRPDSGLSAITELDPGYITGPLS+VWKEW+KWC+EFGIEAN+I+A
Sbjct: 93 MVLDPYNQTDHPECKSRPDSGLSAITELDPGYITGPLSTVWKEWLKWCVEFGIEANAIVA 152
Query: 154 APYDWRLSPSKLEERDLYFHKLKLTFETALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEI 213
PYDWRLSP+KLEERDLYFHKLKLTFETALKLRGGPS+V AHS+GNNVFRYFLEWL+LEI
Sbjct: 153 VPYDWRLSPTKLEERDLYFHKLKLTFETALKLRGGPSIVFAHSMGNNVFRYFLEWLRLEI 212
Query: 214 PPKQYIKWLDEHIHAYFAVGSPFLGATQSVKATLSGETSGLPVSEGTARLMFNSFGSSLW 273
PK Y+KWLD+HIHAYFAVG+P LG+ +++K+TLSG T GLPVSEGTARL+ NSF SSLW
Sbjct: 213 APKHYLKWLDQHIHAYFAVGAPLLGSVEAIKSTLSGVTFGLPVSEGTARLLSNSFASSLW 272
Query: 274 MMPFSKYCRADNKYWKHFSGGT-RKDHHIHQCDEQEFRSNYSGWPTNLINIEIPSIRGLE 332
+MPFSK C+ DN +W HFSGG +KD ++ CDE+E++S YSGWPTN+INIEIPS
Sbjct: 273 LMPFSKNCKGDNTFWTHFSGGAAKKDKRVYHCDEEEYQSKYSGWPTNIINIEIPST---- 328
Query: 333 AYPSVSEVAHNNFSSIECGLPTQLSFSAREISDGTFFKAIEDYDPESKRLLHLLEKSYHG 392
SV+E A N +S+ECGLPT LSF+ARE++DGT FKAIEDYDP+SKR+LH L+K YH
Sbjct: 329 ---SVTETALVNMTSMECGLPTLLSFTARELADGTLFKAIEDYDPDSKRMLHQLKKLYHD 385
Query: 393 DPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDNWIITDVIYEIEGSLFS 452
DPV NPLTPW+RPPIKN+FCIYG KTEVGYYFAPSGKPYPDNWIITD+IYE EGSL S
Sbjct: 386 DPVFNPLTPWERPPIKNVFCIYGAHLKTEVGYYFAPSGKPYPDNWIITDIIYETEGSLVS 445
Query: 453 RSGNLVEGNPGPTSGDETVSLRHFICDC 480
RSG +V+GN GP +GDETV H + C
Sbjct: 446 RSGTVVDGNAGPITGDETVPY-HSLSWC 472
|
|
| POMBASE|SPBC776.14 plh1 "phospholipid-diacylglycerol acyltransferase Plh1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N7N1 MGG_03560 "Phospholipid:diacylglycerol acyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005291 LRO1 "Acyltransferase that catalyzes diacylglycerol esterification" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005049 LRO1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WMP9 PLA2G15 "Group XV phospholipase A2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6XPZ3 PLA2G15 "Group XV phospholipase A2" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010716-3 lcat "lecithin-cholesterol acyltransferase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173244 PDAT "AT5G13640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6948 pla2g15 "phospholipase A2, group XV" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00028542001 | SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (647 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 496 | |||
| pfam02450 | 377 | pfam02450, LACT, Lecithin:cholesterol acyltransfer | 3e-91 | |
| PLN02517 | 642 | PLN02517, PLN02517, phosphatidylcholine-sterol O-a | 1e-16 |
| >gnl|CDD|217043 pfam02450, LACT, Lecithin:cholesterol acyltransferase | Back alignment and domain information |
|---|
Score = 282 bits (723), Expect = 3e-91
Identities = 110/410 (26%), Positives = 155/410 (37%), Gaps = 77/410 (18%)
Query: 73 LDLVWLDTT-KLLSAVNCW--LKCMTLDPYN--QTDNPECKSR-PDSG-LSAITELDPGY 125
+WLD L V+CW M L+ ++P K R P G ++ LD
Sbjct: 1 GFEIWLDLNVFLPRLVDCWIDNTRMVLNKSCWHVMNDPGVKIRPPGFGATQSVEYLDLSK 60
Query: 126 ITGPLSSVWKEWVKWCIEFGIEANSI-IAAPYDWRLSPSKLEERDLYFHKLKLTFETALK 184
I G +W + VK + G E N AAPYDWRLSP++ D YF KLK E ALK
Sbjct: 61 IAGYW--IWHKVVKNLVNIGYERNKTVSAAPYDWRLSPAER---DDYFKKLKQLIEEALK 115
Query: 185 LRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGATQSVK 244
L G +++ HS+GN + YFL W++ E W D+HI A+ ++G+P LG+ ++V+
Sbjct: 116 LSGQKVVLIGHSMGNLLVLYFLLWVEAEG-------WKDQHIDAFISLGAPLLGSPKAVR 168
Query: 245 ATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHHIHQC 304
A SG ++GT L S L P ++ + W F G
Sbjct: 169 ALASGY------NKGTPILSSLSL--KLEKFP-AEQRLTMSSTWGMFPKGGDAWP----- 214
Query: 305 DEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSVSEVAHNNFSSIECGLPTQLSFSAREIS 364
E E + N+ F + L S
Sbjct: 215 -EDEINITTDSYGKNIRQKWDNKTINYTQRDI------QRFFQ-DINLED---GMNPVYS 263
Query: 365 DGTFFKAIEDYDPESKRLLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGY 424
G +K E HGD NPL P ++CIYG+ T GY
Sbjct: 264 QGYMWKDPE-----------------HGDGWSNPLEANLPAPGVKVYCIYGVGLPTPRGY 306
Query: 425 YFAPSGKPYPDNWIITDVIYEIEGSLFSRSGNLVEGNPGPTSGDETVSLR 474
Y+A PD + D ++ E + GD TV
Sbjct: 307 YYAQQ----PDIE-VQDGMFPTEDKV----------EVILGDGDGTVPKV 341
|
Lecithin:cholesterol acyltransferase (LACT) is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. Length = 377 |
| >gnl|CDD|178132 PLN02517, PLN02517, phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 100.0 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 100.0 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 100.0 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 100.0 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 98.82 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.72 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 98.72 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.62 | |
| PLN02965 | 255 | Probable pheophorbidase | 98.3 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 98.21 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.21 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 98.17 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 98.15 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 98.11 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 98.05 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 98.04 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.02 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 98.0 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 97.87 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 97.85 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 97.84 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 97.75 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 97.74 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 97.7 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 97.62 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 97.61 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 97.58 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 97.58 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 97.57 | |
| PLN02511 | 388 | hydrolase | 97.57 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 97.56 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 97.55 | |
| KOG3724 | 973 | consensus Negative regulator of COPII vesicle form | 97.55 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 97.47 | |
| KOG2029 | 697 | consensus Uncharacterized conserved protein [Funct | 97.46 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 97.46 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 97.45 | |
| PLN02872 | 395 | triacylglycerol lipase | 97.44 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 97.38 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 97.36 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 97.36 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 97.33 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 97.32 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 97.31 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 97.26 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 97.24 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 97.23 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 97.21 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 97.2 | |
| PLN02578 | 354 | hydrolase | 97.1 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 97.08 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 97.01 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 96.98 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 96.97 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 96.92 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 96.92 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 96.8 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 96.79 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 96.77 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 96.76 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 96.6 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 96.59 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 96.52 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 96.5 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 96.48 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 96.47 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 96.47 | |
| PLN02606 | 306 | palmitoyl-protein thioesterase | 96.45 | |
| PLN00021 | 313 | chlorophyllase | 96.36 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 96.34 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 96.28 | |
| PLN02633 | 314 | palmitoyl protein thioesterase family protein | 96.06 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 95.97 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 95.96 | |
| PRK10566 | 249 | esterase; Provisional | 95.94 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 95.91 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 95.88 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 95.87 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 95.81 | |
| PF02089 | 279 | Palm_thioest: Palmitoyl protein thioesterase; Inte | 95.79 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 95.74 | |
| KOG2541 | 296 | consensus Palmitoyl protein thioesterase [Lipid tr | 95.45 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 95.43 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 95.41 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 95.36 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 95.36 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 95.3 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 95.26 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 95.17 | |
| PLN02162 | 475 | triacylglycerol lipase | 95.16 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 95.14 | |
| PRK07581 | 339 | hypothetical protein; Validated | 94.97 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 94.78 | |
| PLN00413 | 479 | triacylglycerol lipase | 94.77 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 94.63 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 94.63 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 94.59 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 94.5 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 94.45 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 94.41 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 94.4 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 94.26 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 94.26 | |
| PLN02934 | 515 | triacylglycerol lipase | 94.17 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 94.14 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 94.08 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 93.89 | |
| KOG2624 | 403 | consensus Triglyceride lipase-cholesterol esterase | 93.88 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 93.87 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 93.8 | |
| PLN02408 | 365 | phospholipase A1 | 93.77 | |
| KOG4840 | 299 | consensus Predicted hydrolases or acyltransferases | 93.71 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 93.7 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 93.62 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 93.58 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 93.46 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 93.41 | |
| PLN02310 | 405 | triacylglycerol lipase | 93.33 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 93.2 | |
| PF12048 | 310 | DUF3530: Protein of unknown function (DUF3530); In | 93.17 | |
| PLN02454 | 414 | triacylglycerol lipase | 93.15 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 93.1 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 92.6 | |
| PLN02571 | 413 | triacylglycerol lipase | 92.55 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 92.45 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 92.16 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 91.88 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 91.64 | |
| PLN02802 | 509 | triacylglycerol lipase | 91.59 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 91.52 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 91.07 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 90.96 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 90.78 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 90.15 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 90.01 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 89.69 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 89.61 | |
| PLN02324 | 415 | triacylglycerol lipase | 89.59 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 89.37 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 89.33 | |
| KOG4372 | 405 | consensus Predicted alpha/beta hydrolase [General | 88.91 | |
| PLN02719 | 518 | triacylglycerol lipase | 88.59 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 87.94 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 87.17 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 86.78 | |
| PLN02761 | 527 | lipase class 3 family protein | 86.44 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 86.3 | |
| PLN02847 | 633 | triacylglycerol lipase | 86.13 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 85.87 | |
| PLN02753 | 531 | triacylglycerol lipase | 85.54 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 83.93 | |
| KOG4569 | 336 | consensus Predicted lipase [Lipid transport and me | 83.47 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 83.01 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 82.13 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 81.14 |
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-86 Score=708.43 Aligned_cols=439 Identities=25% Similarity=0.398 Sum_probs=343.9
Q ss_pred CCCCCccEEEeCCccccceeeccccCCCCCCCCCCCCcceecch-hhhhhcccccccceeeccCCCCCCCCcccCCCCCC
Q 010962 37 GDYPKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDT-TKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGL 115 (496)
Q Consensus 37 ~~~~k~PVILVPGi~GS~Lea~~~l~c~~~~~~~~~~~~lWln~-~~ll~~~~Cw~d~m~L~~yn~~~~~Gv~irP~~G~ 115 (496)
+-.+||||||||||++|+||.|....|+.. .|+ +|||++. .+++...+||+++|+||+.++.++|||+|||..|+
T Consensus 70 g~~~khPVVlVPGiiStgLE~W~~~~C~~~--~fr--kRlWg~~~~~~~~~~~CWld~m~LD~~Tg~dppGVkIRa~~G~ 145 (642)
T PLN02517 70 GLTAKHPVVFVPGIVTGGLELWEGHQCAEG--LFR--KRLWGGTFGEVYKRPLCWVEHMSLDNETGLDPPGIRVRAVSGL 145 (642)
T ss_pred CCCcCCCEEEeCchhhcchhhccCcccccc--hhh--hccccchhhheecCHHHHHHhceeCCCCCCCCCCeEEEecCCh
Confidence 446899999999999999999998888753 233 7999964 55555778999999998888889999999998999
Q ss_pred cccccccCCCcccchhhhHHHHHHHHHHcCCccccceecccCCCCCCCchhhhhHHHHHHHHHHHHHHHhcC-CCEEEEE
Q 010962 116 SAITELDPGYITGPLSSVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRG-GPSLVLA 194 (496)
Q Consensus 116 ~aie~Ldp~~~~g~~~~~~~~li~~L~~~GY~~~dL~~apYDWR~s~~~~e~~d~y~~~Lk~lIE~~~~~~g-~pVvLVg 194 (496)
+|+++++|+|+ +|++||++|++.||++.||++||||||+++..++++++||.+||++||++++.+| +||+|||
T Consensus 146 ~AvD~f~pgY~------vw~kLIe~L~~iGY~~~nL~gAPYDWRls~~~le~rd~YF~rLK~lIE~ay~~nggkKVVLV~ 219 (642)
T PLN02517 146 VAADYFAPGYF------VWAVLIANLARIGYEEKNMYMAAYDWRLSFQNTEVRDQTLSRLKSNIELMVATNGGKKVVVVP 219 (642)
T ss_pred heehhccccce------eHHHHHHHHHHcCCCCCceeecccccccCccchhhhhHHHHHHHHHHHHHHHHcCCCeEEEEE
Confidence 99999999985 8999999999999999999999999999998888999999999999999999885 6999999
Q ss_pred eCcchHHHHHHHHHhhhcC--CCcccchhhhhhcceEEEccCCCCCchhhhhhhhcCCCCCCC---------CchHHHH-
Q 010962 195 HSLGNNVFRYFLEWLKLEI--PPKQYIKWLDEHIHAYFAVGSPFLGATQSVKATLSGETSGLP---------VSEGTAR- 262 (496)
Q Consensus 195 HSMGGlv~~~fL~~~~~~~--~p~~~~~Wk~k~I~~~I~lg~P~~Gs~~al~~l~sG~~~glp---------~~~~~~r- 262 (496)
|||||++++|||+|++.+. +....++|++|||+++|+||+||+|++|++++++||++.+++ +....+|
T Consensus 220 HSMGglv~lyFL~wv~~~~~~gG~gG~~W~dKyI~s~I~Iagp~lGs~Kav~allSGE~kdt~~l~a~~~~~l~~~~~r~ 299 (642)
T PLN02517 220 HSMGVLYFLHFMKWVEAPAPMGGGGGPGWCAKHIKAVMNIGGPFLGVPKAVSGLFSAEAKDIAVARAIAPGVLDSDLFGL 299 (642)
T ss_pred eCCchHHHHHHHHhccccccccCCcchHHHHHHHHHheecccccCCcHHHHHHHhccccccchhhcchhhhhhhhhhhcc
Confidence 9999999999999976331 123468999999999999999999999999999999988765 1111222
Q ss_pred -------HHHhhcCCcccccCCcccccCCCcccc-----cccCCCccCCcccccchhhhccc-----CCCCCCceee---
Q 010962 263 -------LMFNSFGSSLWMMPFSKYCRADNKYWK-----HFSGGTRKDHHIHQCDEQEFRSN-----YSGWPTNLIN--- 322 (496)
Q Consensus 263 -------~~~rs~pS~~~LLP~~~~~~~~~~~w~-----~~~~~~~~~~~~~~~~~~~~~~~-----~~~w~~~~v~--- 322 (496)
++.|||+|+++|||.++...|||..|. +|...+++..+.+.++......+ ..... +.|.
T Consensus 300 ~~~~~~~~~~Rs~~si~sMlPkGG~~iWgn~~~apdd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g-~~i~f~~ 378 (642)
T PLN02517 300 QTLQHVMRMTRTWDSTMSMLPKGGETIWGDLDWSPEEGYNCDGKKQKNNDTQLANQDNGNSDVKQKEPVNYG-RIISFGK 378 (642)
T ss_pred hhhHHHHHHHhhhcchHHhccCCcccccCCCCCCCCcccccccccccCcccccccccccccccccccccccc-ceEEecc
Confidence 699999999999999999999999994 34444455544433332111100 01110 1222
Q ss_pred --eecCCcccccCCCCcccccccccc-ccccCCC-c---------------cccccccccccccccccccCCChhHHHHH
Q 010962 323 --IEIPSIRGLEAYPSVSEVAHNNFS-SIECGLP-T---------------QLSFSAREISDGTFFKAIEDYDPESKRLL 383 (496)
Q Consensus 323 --v~~p~~~~~~~~~~~~~~~~~~~~-~~~~~~~-~---------------~~~yta~d~~~g~~f~~~~~~~~~~~~~~ 383 (496)
.+.|++ .++.++....+..++.+ |..|... + +++||+.+..|..+|.+.+++.+...+++
T Consensus 379 ~~~~~~~s-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~l~~~~p~~~~r~~~~~s 457 (642)
T PLN02517 379 DVAEAPSS-QIERIDFKDAVKGNSVASNTSCGDVWTEYHEMGREGIKAVAEYKVYTAGSVLDLLRFVAPKMMQRGDAHFS 457 (642)
T ss_pred cccccccc-ccccccccccccccccccccccccccccccccchhhhhhhhhccCCCHHHHHHHHHhcCHHHHHHhhcccc
Confidence 223333 25566666666666655 6677765 3 67999999999888888877665555556
Q ss_pred HHhhhhccCCCC-------CCCCC-CCCCCCcceEEEEeCCCCCCcceeEeCCCCCCCCCCCceeeeeeccCCeeecccc
Q 010962 384 HLLEKSYHGDPV-------LNPLT-PWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDNWIITDVIYEIEGSLFSRSG 455 (496)
Q Consensus 384 ~~~~~~~~~dp~-------~~~l~-~~~~pP~v~vyclYGvgvpTe~~y~y~~~~~~~~d~~~~~~i~y~~dgtv~~~s~ 455 (496)
++ +++.+++|+ .|||+ ++|+||+|+|||+||||+||||+|+|..+..+ . ++++|.+|.+++..+.
T Consensus 458 ~G-ia~~~~~~~~~~~~~W~NPLe~~LP~AP~mkIyC~YGVG~PTERaY~Y~~~~~~---~---~~l~~~iD~~~~~~~~ 530 (642)
T PLN02517 458 YG-IADNLDDPKYQHYKYWSNPLETKLPNAPEMEIYSLYGVGIPTERSYVYKLSPSD---E---CSIPFQIDTSADGGDE 530 (642)
T ss_pred cc-ccccccccccccccccCChhhccCCCCCCceEEEEecCCCCccceeeeccCCcc---c---ccCceEEecccCCCcc
Confidence 65 333333443 34443 45778999999999999999999999865221 1 2578999999987654
Q ss_pred c-cccCCCcCCCCCccccchhhhccc--ccCCCcccCCCCCc
Q 010962 456 N-LVEGNPGPTSGDETVSLRHFICDC--AFHSKTHLDFGHMS 494 (496)
Q Consensus 456 ~-~~~g~~~~~dGD~TVP~~Sl~~~~--~w~~~~~~~~~~~~ 494 (496)
+ |++++|+++||||||||+|++||| +|++++||||++|+
T Consensus 531 ~~~v~~GV~~~dGDgTVpllS~g~MC~kgW~~~~r~NPag~~ 572 (642)
T PLN02517 531 DSCLKGGVYFVDGDETVPVLSAGFMCAKGWRGKTRFNPSGIR 572 (642)
T ss_pred cccccCceEEecCCCceeehhhhhhhhhhhccCCccCCCCCe
Confidence 4 999999999999999999965555 79999999999986
|
|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >KOG2029 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >PLN02606 palmitoyl-protein thioesterase | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PLN02633 palmitoyl protein thioesterase family protein | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >KOG4569 consensus Predicted lipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 496 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 55.6 bits (133), Expect = 3e-08
Identities = 81/470 (17%), Positives = 138/470 (29%), Gaps = 149/470 (31%)
Query: 106 ECKSRPDSGLSAIT--ELD-----PGYITGPLSSVW------KEWVKWCIEFGIEANSII 152
+CK D S ++ E+D ++G L W +E V+ +E + N
Sbjct: 34 DCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRIN--- 90
Query: 153 AAPYDWRLSPSKLEERD------LYF--------------------HKLKLTFETAL-KL 185
Y + +SP K E+R +Y + L AL +L
Sbjct: 91 ---YKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL 147
Query: 186 RGGPSLVLAH--------SLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVG---S 234
R ++++ + +V + K++ I WL+ + S
Sbjct: 148 RPAKNVLI-DGVLGSGKTWVALDVCLSY----KVQCKMDFKIFWLN--------LKNCNS 194
Query: 235 P--FLGATQSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSK-YCRA-------- 283
P L Q + + + +L +S + L + SK Y
Sbjct: 195 PETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQ 254
Query: 284 DNKYWKHFSGG------TRKDHHIHQCDEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSV 337
+ K W F+ TR +Q + T++ L
Sbjct: 255 NAKAWNAFNLSCKILLTTR--------FKQVTDFLSAATTTHISLDHHSM--TLTPDEVK 304
Query: 338 SEVAHNNFSSIECG-LPTQ--------LSFSAREISDGTFFKAIEDY--DPESKRLLHLL 386
S + + LP + LS A I D A D +L ++
Sbjct: 305 SLLL--KYLDCRPQDLPREVLTTNPRRLSIIAESIRD---GLATWDNWKHVNCDKLTTII 359
Query: 387 EKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDN-----W--II 439
E S LN L P + + +F + F P P W +I
Sbjct: 360 ESS------LNVLEPAE---YRKMFDRLSV---------F-PPSAHIPTILLSLIWFDVI 400
Query: 440 TDVIYEIEGSLFSRSGNLVEGNPGPTSGDETVSLRHFICDCAFHSKTHLD 489
+ + L S LVE P + T+S+ K L+
Sbjct: 401 KSDVMVVVNKLHKYS--LVEKQP----KESTISI-P---SIYLELKVKLE 440
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 98.73 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 98.67 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 98.59 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 98.57 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 98.56 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 98.49 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 98.47 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.37 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 98.35 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 98.34 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 98.31 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.29 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 98.27 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 98.24 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 98.24 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 98.16 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 98.16 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 98.16 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 98.15 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 98.15 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 98.14 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 98.14 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 98.14 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 98.12 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.11 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 98.11 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 98.09 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 98.08 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 98.08 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 98.04 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 98.02 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 97.99 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 97.99 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 97.98 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 97.98 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 97.96 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 97.96 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 97.96 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 97.94 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 97.94 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 97.93 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 97.93 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 97.92 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 97.91 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 97.91 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 97.9 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 97.9 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 97.89 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 97.89 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 97.87 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 97.87 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 97.86 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 97.86 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 97.86 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 97.86 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 97.86 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 97.85 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 97.85 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 97.84 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 97.84 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 97.84 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 97.82 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 97.82 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 97.81 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 97.8 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 97.8 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 97.79 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 97.79 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 97.78 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 97.78 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 97.77 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 97.77 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 97.77 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 97.77 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 97.76 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 97.75 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 97.74 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 97.74 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 97.73 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 97.72 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 97.72 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 97.71 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 97.7 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 97.68 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 97.66 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 97.66 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 97.66 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 97.65 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 97.65 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 97.62 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 97.6 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 97.6 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 97.58 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 97.57 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 97.55 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 97.54 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 97.54 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 97.52 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 97.51 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 97.51 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 97.5 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 97.5 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 97.49 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 97.47 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 96.59 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 97.43 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 97.43 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 97.42 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 97.42 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 97.41 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 97.4 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 97.39 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 97.38 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 97.38 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 97.36 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 97.36 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 97.36 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 97.34 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 97.32 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 97.32 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 97.31 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 97.31 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 97.3 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 97.25 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 97.24 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 97.22 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 97.18 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 97.18 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 97.14 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 97.13 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 97.12 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 97.12 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 97.12 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 97.11 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 97.1 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 97.1 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 97.08 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 97.08 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 97.03 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 97.01 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 97.0 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 96.97 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 96.96 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 96.88 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 96.87 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 96.85 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 96.85 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 96.85 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 96.84 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 96.84 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 96.83 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 96.82 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 96.81 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 96.79 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 96.75 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 96.75 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 96.73 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 96.72 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 96.7 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 96.68 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 96.66 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 96.65 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 96.64 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 96.58 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 96.56 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 96.55 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 96.55 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 96.53 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 96.52 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 96.5 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 96.49 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 96.49 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 96.4 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 96.39 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 96.38 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 96.38 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 96.37 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 96.36 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 96.3 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 96.3 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 96.3 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 96.28 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 96.27 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 96.24 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 96.22 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 96.14 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 96.13 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 96.0 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 95.96 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 95.95 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 95.93 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 95.92 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 95.91 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 95.9 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 95.89 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 95.87 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 95.78 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 95.75 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 95.6 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 95.58 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 95.57 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 95.57 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 95.53 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 95.5 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 95.47 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 95.41 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 95.28 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 95.26 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 95.19 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 95.18 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 94.88 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 94.87 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 94.75 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 94.71 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 94.67 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 94.6 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 94.59 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 94.56 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 94.35 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 93.96 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 93.88 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 93.8 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 93.52 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 93.52 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 93.08 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 92.77 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 92.76 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 92.45 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 92.29 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 92.12 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 91.94 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 91.0 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 90.94 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 90.64 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 90.59 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 90.05 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 89.99 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 89.94 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 89.82 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 89.56 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 89.33 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 89.33 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 88.52 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 88.31 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 88.31 |
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
Probab=98.73 E-value=2.3e-08 Score=101.67 Aligned_cols=92 Identities=14% Similarity=0.204 Sum_probs=68.9
Q ss_pred hhHH-HHHHHHHHcCCcc--ccceecccCCCCCCCchhhhhHHHHHHHHHHHHHHHhcC-CCEEEEEeCcchHHHHHHHH
Q 010962 132 SVWK-EWVKWCIEFGIEA--NSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRG-GPSLVLAHSLGNNVFRYFLE 207 (496)
Q Consensus 132 ~~~~-~li~~L~~~GY~~--~dL~~apYDWR~s~~~~e~~d~y~~~Lk~lIE~~~~~~g-~pVvLVgHSMGGlv~~~fL~ 207 (496)
..|. .+++.|.+.||.. .|+.++. .. ......+++.+.|+++.+..| +||+||||||||++++++++
T Consensus 80 ~~w~~~l~~~L~~~Gy~V~a~DlpG~G------~~---~~~~~~~~la~~I~~l~~~~g~~~v~LVGHSmGGlvA~~al~ 150 (316)
T 3icv_A 80 QSFDSNWIPLSAQLGYTPCWISPPPFM------LN---DTQVNTEYMVNAITTLYAGSGNNKLPVLTWSQGGLVAQWGLT 150 (316)
T ss_dssp HHHTTTHHHHHHHTTCEEEEECCTTTT------CS---CHHHHHHHHHHHHHHHHHHTTSCCEEEEEETHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHCCCeEEEecCCCCC------CC---cHHHHHHHHHHHHHHHHHHhCCCceEEEEECHHHHHHHHHHH
Confidence 3677 8999999999953 2443322 11 123356778888988887777 69999999999999999988
Q ss_pred HhhhcCCCcccchhhhhhcceEEEccCCCCCchhh
Q 010962 208 WLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGATQS 242 (496)
Q Consensus 208 ~~~~~~~p~~~~~Wk~k~I~~~I~lg~P~~Gs~~a 242 (496)
.... ..+.|+++|+||+|+.|+..+
T Consensus 151 ~~p~----------~~~~V~~lV~lapp~~Gt~~a 175 (316)
T 3icv_A 151 FFPS----------IRSKVDRLMAFAPDYKGTVLA 175 (316)
T ss_dssp HCGG----------GTTTEEEEEEESCCTTCBSCC
T ss_pred hccc----------cchhhceEEEECCCCCCchhh
Confidence 6321 125699999999999998775
|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 99.12 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 98.85 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 98.83 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 98.75 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.57 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 98.47 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 98.45 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 98.4 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 98.28 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 98.14 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 98.13 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 98.07 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 98.01 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 97.98 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 97.96 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 97.96 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 97.94 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 97.94 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 97.83 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 97.81 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 97.79 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 97.77 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 97.74 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 97.73 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 97.71 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 97.67 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 97.67 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 97.65 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 97.58 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 97.49 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 97.3 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 97.27 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 97.21 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 97.18 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 97.01 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 97.0 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 96.96 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 96.93 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 96.87 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 96.84 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 96.6 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 96.13 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 95.98 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 95.95 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 95.89 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 95.85 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 95.82 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 95.7 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 95.64 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 95.32 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 94.88 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 94.65 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 94.33 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 94.16 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 93.91 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 92.9 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 92.54 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 92.42 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 92.03 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 91.94 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 91.61 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 90.7 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 90.43 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 89.79 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 89.74 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 89.32 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 89.17 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 88.7 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 88.54 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 87.8 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 85.28 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 83.57 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 83.43 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 83.11 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 81.89 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 80.92 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 80.19 |
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Bacterial lipase domain: Lipase A species: Bacillus subtilis [TaxId: 1423]
Probab=99.12 E-value=7e-11 Score=106.65 Aligned_cols=94 Identities=14% Similarity=0.111 Sum_probs=70.1
Q ss_pred hhHHHHHHHHHHcCCccccceecccCCCCCCCchhhhhHHHHHHHHHHHHHHHhcC-CCEEEEEeCcchHHHHHHHHHhh
Q 010962 132 SVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRG-GPSLVLAHSLGNNVFRYFLEWLK 210 (496)
Q Consensus 132 ~~~~~li~~L~~~GY~~~dL~~apYDWR~s~~~~e~~d~y~~~Lk~lIE~~~~~~g-~pVvLVgHSMGGlv~~~fL~~~~ 210 (496)
..|..+++.|.+.||....+....|... ... .....+.+.+.|++..+..+ ++|+||||||||++++++++...
T Consensus 16 ~~~~~l~~~l~~~g~~~~~~~~~~~~~~--~~~---~~~~~~~l~~~i~~~~~~~~~~~v~lvGHSmGG~va~~~~~~~~ 90 (179)
T d1ispa_ 16 FNFAGIKSYLVSQGWSRDKLYAVDFWDK--TGT---NYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLD 90 (179)
T ss_dssp GGGHHHHHHHHHTTCCGGGEEECCCSCT--TCC---HHHHHHHHHHHHHHHHHHHCCSCEEEEEETHHHHHHHHHHHHSS
T ss_pred HHHHHHHHHHHHcCCeEEEEecCCcccc--ccc---cchhhhhHHHHHHHHHHhcCCceEEEEeecCcCHHHHHHHHHcC
Confidence 3688999999999997654444444332 221 13356778888888877666 58999999999999999998642
Q ss_pred hcCCCcccchhhhhhcceEEEccCCCCCchh
Q 010962 211 LEIPPKQYIKWLDEHIHAYFAVGSPFLGATQ 241 (496)
Q Consensus 211 ~~~~p~~~~~Wk~k~I~~~I~lg~P~~Gs~~ 241 (496)
. .+.|+++|+||+|+.|+..
T Consensus 91 ~-----------~~~V~~~V~l~~p~~g~~~ 110 (179)
T d1ispa_ 91 G-----------GNKVANVVTLGGANRLTTG 110 (179)
T ss_dssp G-----------GGTEEEEEEESCCGGGTCS
T ss_pred C-----------chhhCEEEEECCCCCCchh
Confidence 1 2459999999999987643
|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|