Citrus Sinensis ID: 011000

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490------
MSGLTVARLQLFHYPSSTVRTTVISSKLHHSFPSSNRYRPRTLHNFSTSGIAQSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSEETSVEPKEKSSTSSSKVTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF
cccccccccEEEcccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEEEEEEcccccccccEEEEEEcccccccccccccccccccEEEEEccccccEEEEEEccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEECcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcEEEEccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHccccCEEEcccccccccccHHHHHHccccccEEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccc
*****VARLQLFHYPSSTVRTTVI***********************************IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATK******************VTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLTVARLQLFHYPSSTVRTTVISSKLHHSFPSSNRYRPRTLHNFSTSGIAQSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSEETSVEPKEKSSTSSSKVTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartyl aminopeptidase Likely to play an important role in intracellular protein and peptide metabolism.probableQ5RBT2
Aspartyl aminopeptidase Likely to play an important role in intracellular protein and peptide metabolism.probableQ9ULA0
Aspartyl aminopeptidase Likely to play an important role in intracellular protein and peptide metabolism.probableQ54M70

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.11.-Aminopeptidases.probable
3.4.11.21Aspartyl aminopeptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EME, chain A
Confidence level:very confident
Coverage over the Query: 234-495
View the alignment between query and template
View the model in PyMOL
Template: 2GLJ, chain A
Confidence level:very confident
Coverage over the Query: 36-483
View the alignment between query and template
View the model in PyMOL