Citrus Sinensis ID: 011022

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MAADKVVETVVVGNYVEMETEGKPQNMKSKLSNFFWHGGSVYDAWFSCSSNQVAQVLLTLPYSFSQLGMLSGILFQLFYGLLGSWTAYLISILYVEYRTRKEREKVDFRNHVIQWFEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLLMTTYTAWYLTIASLLHGQVEGVKHAGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILMLIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINSTVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVVGFGFGGWASMTNFIHQIDTFGLFTKCYQCLPPQGVLPPPPHSFNTTVAPSPHHQPSFNHTHHNL
ccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccEEHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
******************************LSNFFWHGGSVYDAWFSCSSNQVAQVLLTLPYSFSQLGMLSGILFQLFYGLLGSWTAYLISILYVEYRTRKEREKVDFRNHVIQWFEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLLMTTYTAWYLTIASLLHGQVEGVKHAGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILMLIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINSTVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVVGFGFGGWASMTNFIHQIDTFGLFTKCYQCLPPQG******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAADKVVETVVVGNYVEMETEGKPQNMKSKLSNFFWHGGSVYDAWFSCSSNQVAQVLLTLPYSFSQLGMLSGILFQLFYGLLGSWTAYLISILYVEYRTRKEREKVDFRNHVIQWFEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLLMTTYTAWYLTIASLLHGQVEGVKHAGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILMLIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINSTVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVVGFGFGGWASMTNFIHQIDTFGLFTKCYQCLPPQGVLPPPPHSFNTTVAPSPHHQPSFNHTHHNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin transporter-like protein 2 Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex.confidentQ9S836
Auxin transporter-like protein 2 Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex (By similarity). May be involved in lateral roots and nodules formation.probableQ9FEL7
Auxin transporter-like protein 3 Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex (By similarity). May be involved in lateral roots and nodules formation.probableQ9FEL6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 36-216,227-286
View the alignment between query and template
View the model in PyMOL