Citrus Sinensis ID: 011023

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----

MSFLTGFGVLMEKSARTEQVERKVLNFTKEILSATSFSRQLAEQIILAKAYVIIAKEHNNHRLAWELSKKIRSCQLLLSKAAMRGEPITLDEAEPIISSLSSLIFTAQDAHYDIATTIMTMKSHIQALEERANAATVQSTLFGQLLAESLPKSLHCLKVKLSVDWVRSKHIQDLASERRNSPRLVDNNLYHFCIFSDNVPATSVVVNSTITNADHPKQMVFHIVTNGVTYGAMQAWFLNNDFKGSTIEVQNIEEFSWLNASYAPIVKQLLNADSRAIYFGEYQDLRVEPKLRNPRYLSLLNHLRFYIPEIYPQLEKIVFLDDDVVVQKDLTPLFSLDLHGNVNGAVETCLEAFHRYYKYLNFSNPIISSKFDPQACGWAFGMNAFDLIAWRKANVTARYHYWQEQNADRTLWKLGTLPPALLAFYGLTEPLDRRWHVLGLGYDMNIDNRLIESAAVIHFNGNMKPWLKLAISRYKPIWDRYVNHSHPYVQDCETS

ccccccccEEccccccHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHccccccccEEEEEcccccccccccHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHcccccccccEEEECccEEEccccHHHHccccccccccccHHHHHHHHHHccccccccHHHHccccccccccccccHHccHHHHHHHcHHHHHHHHHHHccccccccccccccHHHHccccCECccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHccccccHHHHcccc

*****GFGVLM********VERKVL*F*KEILSATSFSRQLAEQIILAKAYVIIAKEHNNHRLAWELSKKIRSCQLLLSKAAMRGEPITLDEAEPIISSLSSLIFTAQDAHYDIATTIMTMKSHIQALEERANAATVQSTLFGQLLAESLPKSLHCLKVKLSVDWVRSKHIQDLA******PRLVDNNLYHFCIFSDNVPATSVVVNSTITNADHPKQMVFHIVTNGVTYGAMQAWFLNNDFKGSTIEVQNIEEFSWLNASYAPIVKQLLNADSRAIYFGEYQDLRVEPKLRNPRYLSLLNHLRFYIPEIYPQLEKIVFLDDDVVVQKDLTPLFSLDLHGNVNGAVETCLEAFHRYYKYLNFSNPIISSKFDPQACGWAFGMNAFDLIAWRKANVTARYHYWQEQNADRTLWKLGTLPPALLAFYGLTEPLDRRWHVLGLGYDMNIDNRLIESAAVIHFNGNMKPWLKLAISRYKPIWDRYVNHSHPYVQDCET*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable galacturonosyltransferase 11	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity). Involved in seed mucilage extrusion.	confident	Q949Q1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G9R, chain A
Confidence level:very confident
Coverage over the Query: 191-257,279-483
View the alignment between query and template
View the model in PyMOL