Citrus Sinensis ID: 011028

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MDFELNYEIASTADFIYSRKFTRVALQFPDNLLKDSIRIVRALRAKLGSLRSSDGERGVDDKDIGLFVMADTTYGSCCVDEVGASHVDADCVIHYGHTCLSPTSTLPAFFVFGKASINTSNCIENLSKHALTNGKPILVLYGLEYAHAIPHIREAVKVASSSYGSGLKLEINFADVMCTVITPSKDHKSLCGPAGGCTRHTIGGLVWNIPDRKKMEEHLLFWIGSDNSAFANVVLTFNGCEIVRYDATEERLLTDVSQPLKILKRRYYLVEKAKDANIIGVLVGTLGVAGYLHMIHQMKELITKAGKKAYTLVMGKPNPAKLANFPECDVFINVSCAQTALLDSKEFLAPVITPFEAMLAFGRGTQWTGAYVMEFRDLMSSSPVEGSDQAEEARFSFLKGGYVEDVAQPETENGEEEKEGALALANAAEKALQLRDRSLDPIVKGTAKSGAEYFVSRSYHGLEMQCNSSSPEPYAIGRSGKASGYDDEKSKQEIQ
ccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccCEEEEEcccccccccccHHHHccccccEEEEcccccccccccccEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHcccccccccCCccccccccCCccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccCEEEEccccccCEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHcccccccEEEEEEcccccccccccccccCCccHHHHHHccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHccccccEEEccccHHHHHHHcccccccccccccccccccccccccccccccccccccccc
MDFELNYEIASTADFIYSRKFTRVALQFPDNLLKDSIRIVRALRAKLGSLRSSDGERGVDDKDIGLFVMADTTYGSCCVDEVGASHVDADCVIHYGHTCLSPTSTLPAFFVFGKASINTSNCIENLSKHALTNGKPILVLYGLEYAHAIPHIREAVKVASSSYGSGLKLEINFADVMCTVITPSKDHKSLCGPAGGCTRHTIGGLVWNIPDRKKMEEHLLFWIGSDNSAFANVVLTFNGCEIVRYDATEERLLTDVSQPLKILKRRYYLVEKAKDANIIGVLVGTLGVAGYLHMIHQMKELITKAGKKAYTLVMGKPNPAKLANFPECDVFINVSCAQTALLDSKEFLAPVITPFEAMLAFGRGTQWTGAYVMEFRDLMSS***************FLK**Y**********************************************SGAEYFVSRSYHGLEMQCNSSSPEPYAIGRSGKA*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFELNYEIASTADFIYSRKFTRVALQFPDNLLKDSIRIVRALRAKLGSLRSSDGERGVDDKDIGLFVMADTTYGSCCVDEVGASHVDADCVIHYGHTCLSPTSTLPAFFVFGKASINTSNCIENLSKHALTNGKPILVLYGLEYAHAIPHIREAVKVASSSYGSGLKLEINFADVMCTVITPSKDHKSLCGPAGGCTRHTIGGLVWNIPDRKKMEEHLLFWIGSDNSAFANVVLTFNGCEIVRYDATEERLLTDVSQPLKILKRRYYLVEKAKDANIIGVLVGTLGVAGYLHMIHQMKELITKAGKKAYTLVMGKPNPAKLANFPECDVFINVSCAQTALLDSKEFLAPVITPFEAMLAFGRGTQWTGAYVMEFRDLMSSSPVEGSDQAEEARFSFLKGGYVEDVAQPETENGEEEKEGALALANAAEKALQLRDRSLDPIVKGTAKSGAEYFVSRSYHGLEMQCNSSSPEPYAIGRSGKASGYDDEKSKQEIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diphthamide biosynthesis protein 2 Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.probableQ10206
Diphthamide biosynthesis protein 2 Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.probableQ5ZKI2
Diphthamide biosynthesis protein 2 Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.probableA4QN59

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LZD, chain A
Confidence level:very confident
Coverage over the Query: 4-45,62-375
View the alignment between query and template
View the model in PyMOL
Template: 3LZC, chain A
Confidence level:probable
Coverage over the Query: 59-178,189-197,208-362
View the alignment between query and template
View the model in PyMOL