Citrus Sinensis ID: 011042

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----

MAFSQTTLLLKQVLLLHLLCSIITTSTSAASDTHFQILNVNESIKGSRTDHAKMSQYNELFERHNNISSSNTSSDEARWNLELVHRDKMSSSSNTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFSGVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHKNQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAAWVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPAYEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLIPVDDAGTFCFAFAPSPSGLSIIGNIQQEGIQISFDGANGFVGFGPNVC

ccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccccccHHHHHHccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEcccccCEEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccCEEEEEEEEEEEEcccccccEEEEEccccccccccccEEEEcccccccHHHHccccccccEEEEccccccccccEEEEcccccccccCECccccccccccEEEEEEEEEEEccEEEccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccEEECccccEEEEEccccEEEEEECccccccEEEEEEEEEEEEEEEEccccEEEECcccc

****QTTLLLKQVLLLHLLCSIITTSTSAASDTHFQILNVN******************************************VHRDK***********************M*R*VKRVATLVRRL**************FGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFSGVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHKNQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAAWVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPAYEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLIPVDDAGTFCFAFAPSPSGLSIIGNIQQEGIQISFDGANGFVGFGPNVC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein ASPARTIC PROTEASE IN GUARD CELL 2	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	confident	Q9LHE3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QDM, chain A
Confidence level:very confident
Coverage over the Query: 141-209,228-494
View the alignment between query and template
View the model in PyMOL

Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 137-187,201-493
View the alignment between query and template
View the model in PyMOL