Citrus Sinensis ID: 011042


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MAFSQTTLLLKQVLLLHLLCSIITTSTSAASDTHFQILNVNESIKGSRTDHAKMSQYNELFERHNNISSSNTSSDEARWNLELVHRDKMSSSSNTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFSGVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHKNQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAAWVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPAYEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLIPVDDAGTFCFAFAPSPSGLSIIGNIQQEGIQISFDGANGFVGFGPNVC
ccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccccccHHHHHHccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEcccccCEEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccCEEEEEEEEEEEEcccccccEEEEEccccccccccccEEEEcccccccHHHHccccccccEEEEccccccccccEEEEcccccccccCECccccccccccEEEEEEEEEEEccEEEccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccEEECccccEEEEEccccEEEEEECccccccEEEEEEEEEEEEEEEEccccEEEECcccc
****QTTLLLKQVLLLHLLCSIITTSTSAASDTHFQILNVN******************************************VHRDK***********************M*R*VKRVATLVRRL**************FGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFSGVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHKNQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAAWVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPAYEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLIPVDDAGTFCFAFAPSPSGLSIIGNIQQEGIQISFDGANGFVGFGPNVC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSQTTLLLKQVLLLHLLCSIITTSTSAASDTHFQILNVNESIKGSRTDHAKMSQYNELFERHNNISSSNTSSDEARWNLELVHRDKMSSSSNTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFSGVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHKNQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAAWVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPAYEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLIPVDDAGTFCFAFAPSPSGLSIIGNIQQEGIQISFDGANGFVGFGPNVC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ASPARTIC PROTEASE IN GUARD CELL 2 Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.confidentQ9LHE3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QDM, chain A
Confidence level:very confident
Coverage over the Query: 141-209,228-494
View the alignment between query and template
View the model in PyMOL
Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 137-187,201-493
View the alignment between query and template
View the model in PyMOL