Citrus Sinensis ID: 011056


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----
MPQDERQRSKSRASTSRAVARPPARAKVPLRKLLKVASVAGGIQFGWALQLSLLTPYVQELGIPHAWASIIWLCGPVSGLFVQPLVGHFSDRCTSRFGRRRPFIVCGAISIAVAVLLIGLSADIGWLLGDRGDFRPRAIAVFVFGFWILDVANNMTQGKDHRRTRVANAYFSLFMAVGNILGYATGSFSGWFKILPFTLTSACNVDCANLKSAFFLDVIFIAITTCISASAAHEVPLGSHDQSAPFSEEGHEQSSDVHEAFLWELFGTFRYFSGTIWIILIVTALTWLGWFPFLLFDTDWMGREIYGGEPNEGQNYATGVRMGALGLMLNSVVLGITSVLMEKLCRKWGAGFIWGISNILMALCFLAMLILYYVAIHMDYRGHDLPPNGIVIAALIIFTILGGPLAITYSVPYALVSIRTESLGLGQGLSLGVLNLAIVIPQIVVSMGSGPWDQLFGGGNSPAFAVGGISALAGGLIAILAIPRSSAQKPRALP
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccEECccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEccccccccccccc
***************************VPLRKLLKVASVAGGIQFGWALQLSLLTPYVQELGIPHAWASIIWLCGPVSGLFVQPLVGHFSDRCTSRFGRRRPFIVCGAISIAVAVLLIGLSADIGWLLGDRGDFRPRAIAVFVFGFWILDVANNMTQGKDHRRTRVANAYFSLFMAVGNILGYATGSFSGWFKILPFTLTSACNVDCANLKSAFFLDVIFIAITTCISASAAHEVPLGSH*************SSDVHEAFLWELFGTFRYFSGTIWIILIVTALTWLGWFPFLLFDTDWMGREIYGGEPNEGQNYATGVRMGALGLMLNSVVLGITSVLMEKLCRKWGAGFIWGISNILMALCFLAMLILYYVAIHMDYRGHDLPPNGIVIAALIIFTILGGPLAITYSVPYALVSIRTESLGLGQGLSLGVLNLAIVIPQIVVSMGSGPWDQLFGGGNSPAFAVGGISALAGGLIAILAI************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQDERQRSKSRASTSRAVARPPARAKVPLRKLLKVASVAGGIQFGWALQLSLLTPYVQELGIPHAWASIIWLCGPVSGLFVQPLVGHFSDRCTSRFGRRRPFIVCGAISIAVAVLLIGLSADIGWLLGDRGDFRPRAIAVFVFGFWILDVANNMTQGKDHRRTRVANAYFSLFMAVGNILGYATGSFSGWFKILPFTLTSACNVDCANLKSAFFLDVIFIAITTCISASAAHEVPLGSHDQSAPFSEEGHEQSSDVHEAFLWELFGTFRYFSGTIWIILIVTALTWLGWFPFLLFDTDWMGREIYGGEPNEGQNYATGVRMGALGLMLNSVVLGITSVLMEKLCRKWGAGFIWGISNILMALCFLAMLILYYVAIHMDYRGHDLPPNGIVIAALIIFTILGGPLAITYSVPYALVSIRTESLGLGQGLSLGVLNLAIVIPQIVVSMGSGPWDQLFGGGNSPAFAVGGISALAGGLIAILAIPRSSAQKPRALP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sucrose transport protein SUC4 Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport maltose at a lesser rate. May also transport biotin.confidentQ9FE59
Sucrose transport protein SUT2 Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). May also transport other glucosides.probableQ0ILJ3
Sucrose transport protein Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport maltose at a lesser rate.probableQ03411

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O7Q, chain A
Confidence level:confident
Coverage over the Query: 28-310,321-372,390-477
View the alignment between query and template
View the model in PyMOL
Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 32-197,208-262,273-466
View the alignment between query and template
View the model in PyMOL