Citrus Sinensis ID: 011061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----
MFQAEEEALLFQQHAVGENSGQFEETVHPYISKVLMEGNFKPSKTEQDHAFLLQLLFWFKQTFRWVNAPPCDGCSNETVGQGMGTPLPSEIQYGAARVELFRCKVCSKITRFPRYNDPLKLVETKRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSQSLGRWMHLDPCEGIYDRPLLYEKGWNKKLNYVIAISKDGVFDVTKRYTRKWHEVLSRRNIATEQTVSAVLAKMTRECRRSFASETLSTLEDRDKCEREAMERDLYSTDDAPVSLPGRQSGDKEWRISRSEIGSDDNCSLSCSSCPVRVCIDEHVTTIYNAFSSVLSHFVENNVPKSGAIELLKILKGILGDLKKSPYKTRRVSLNSVPNNGQKIVHQLLPSIGHLLRVLSLKSELNTDGRVDIVLAGDPVKTSLSLPVVFKALDDMIHDLNNCDNFGKGSFCLPLLKLNRIHSGSVLASGEEFPFGIVTSAFDGIRPSKWEDLMAREVVG
ccccHHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHccccEEEEEEcccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHcccccEEEEccccEEEEEEccccccEEEEcccccccccccEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcccHHHHHEEEEEEEEEccccCEEEEECcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccccEEEcccccccccHHHHHHHHHHcc
*FQAEEEALL*************EETVHPYISKVLMEGNF******QDHAFLLQLLFWFKQTFRWVNAPPCDGCSN*******GTPLPSEIQYGAARVELFRCKVCSKITRFPRYNDPLKLVETKRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSQSLGRWMHLDPCEGIYDRPLLYEKGWNKKLNYVIAISKDGVFDVTKRYTRKWHEVLSRRNIATEQTVSAVLAKMTRECR********STLEDRDK************************************************SCPVRVCIDEHVTTIYNAFSSVLSHFVENNVPKSGAIELLKILKGILGDLKKSPYKTRRVSLNSVPNNGQKIVHQLLPSIGHLLRVLSLKSELNTDGRVDIVLAGDPVKTSLSLPVVFKALDDMIHDLNNCDNFGKGSFCLPLLKLNRIHSGSVLASGEEFPFGIVTSAFDGIRPSKWEDLMAREVV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQAEEEALLFQQHAVGENSGQFEETVHPYISKVLMEGNFKPSKTEQDHAFLLQLLFWFKQTFRWVNAPPCDGCSNETVGQGMGTPLPSEIQYGAARVELFRCKVCSKITRFPRYNDPLKLVETKRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSQSLGRWMHLDPCEGIYDRPLLYEKGWNKKLNYVIAISKDGVFDVTKRYTRKWHEVLSRRNIATEQTVSAVLAKMTRECRRSFASETLSTLEDRDKCEREAMERDLYSTDDAPVSLPGRQSGDKEWRISRSEIGSDDNCSLSCSSCPVRVCIDEHVTTIYNAFSSVLSHFVENNVPKSGAIELLKILKGILGDLKKSPYKTRRVSLNSVPNNGQKIVHQLLPSIGHLLRVLSLKSELNTDGRVDIVLAGDPVKTSLSLPVVFKALDDMIHDLNNCDNFGKGSFCLPLLKLNRIHSGSVLASGEEFPFGIVTSAFDGIRPSKWEDLMAREVVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Specifically deglycosylates the denatured form of N-linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation. Cleaves the beta-aspartyl-glucosamine (GlcNAc) of the glycan and the amide side chain of Asn, converting Asn to Asp. Prefers proteins containing high-mannose over those bearing complex type oligosaccharides. Can recognize misfolded proteins in the endoplasmic reticulun that are exported in the cytosol to be destroyed and deglycosylate them, while it has no activity toward native proteins. Deglycosylation is prerequisite for subsequent proteasome-mediated degradation of some, but not all, misfolded glycoproteins.probableQ9FGY9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.52Transferred entry: 3.5.1.52.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F4M, chain A
Confidence level:very confident
Coverage over the Query: 46-267
View the alignment between query and template
View the model in PyMOL
Template: 2QSF, chain A
Confidence level:confident
Coverage over the Query: 50-242,254-326
View the alignment between query and template
View the model in PyMOL
Template: 2G9G, chain A
Confidence level:confident
Coverage over the Query: 280-412
View the alignment between query and template
View the model in PyMOL
Template: 1EX0, chain A
Confidence level:probable
Coverage over the Query: 21-69,81-99,119-176
View the alignment between query and template
View the model in PyMOL