Citrus Sinensis ID: 011091

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----

MEEDLLVSGEASGNNRNNDNNRRRRGPTALFRRRTDAITRGSPYQKAAALVDLAEDGIGLPEEILDRSSFESSAKFYFIFIKFDYIWSLNYFALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTVWLEFIDSNFLCLFLINICDICLNKTD

cccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHccccccHHHccccccccccHHHEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccEEHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccc

***DLL*************************************YQKAAALVDLAEDGIGLPEEILDRSSFESSAKFYFIFIKFDYIWSLNYFALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQV****RMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTVWLEFIDSNFLCLFLINICDICLNKT*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHxxxHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Two pore calcium channel protein 1	Functions as a voltage-gated inward-rectifying Ca(2+) channel (VDCC) across the vacuole membrane. Is one of the essential components of the slow vacuolar (SV) channel. Acts as the major ROS-responsive Ca(2+) channel and is the possible target of Al-dependent inhibition. Involved in the regulation of germination and stomatal movement.	probable	Q94KI8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RVY, chain A
Confidence level:very confident
Coverage over the Query: 72-108,128-182,193-323
View the alignment between query and template
View the model in PyMOL

Template: 2SAS, chain A
Confidence level:confident
Coverage over the Query: 339-410
View the alignment between query and template
View the model in PyMOL

Template: 3RVY, chain A
Confidence level:confident
Coverage over the Query: 434-492
View the alignment between query and template
View the model in PyMOL