Citrus Sinensis ID: 011091
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 494 | ||||||
| 225446362 | 680 | PREDICTED: two pore calcium channel prot | 0.923 | 0.670 | 0.740 | 0.0 | |
| 302143292 | 732 | unnamed protein product [Vitis vinifera] | 0.923 | 0.622 | 0.740 | 0.0 | |
| 197215947 | 680 | two pore channel 1 [Vitis vinifera] | 0.923 | 0.670 | 0.740 | 0.0 | |
| 255553747 | 743 | Voltage-dependent L-type calcium channel | 0.927 | 0.616 | 0.747 | 0.0 | |
| 449438094 | 738 | PREDICTED: two pore calcium channel prot | 0.880 | 0.589 | 0.736 | 0.0 | |
| 449479156 | 550 | PREDICTED: two pore calcium channel prot | 0.880 | 0.790 | 0.737 | 0.0 | |
| 297813953 | 732 | two-pore channel 1 [Arabidopsis lyrata s | 0.908 | 0.613 | 0.698 | 0.0 | |
| 18412295 | 733 | two pore calcium channel protein 1 [Arab | 0.884 | 0.596 | 0.710 | 1e-180 | |
| 224121708 | 726 | predicted protein [Populus trichocarpa] | 0.902 | 0.614 | 0.717 | 1e-180 | |
| 14041819 | 733 | two-pore calcium channel [Arabidopsis th | 0.884 | 0.596 | 0.706 | 1e-180 |
| >gi|225446362|ref|XP_002273215.1| PREDICTED: two pore calcium channel protein 1A [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 686 bits (1770), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 345/466 (74%), Positives = 401/466 (86%), Gaps = 10/466 (2%)
Query: 6 LVSGEASGNNRNNDNNRRRRGPTALFRRRTDAITRGSPYQKAAALVDLAEDGIGLPEEIL 65
L+ GE+SG RRRG T +F RR+DAI GSPYQKAAALVDLAEDGIGLPE++L
Sbjct: 5 LLDGESSGG--------RRRGQTPVFHRRSDAIAYGSPYQKAAALVDLAEDGIGLPEQML 56
Query: 66 DRSSFESSAKFYFIFIKFDYIWSLNYFALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLG 125
D+ SFES+AKFYFIFI+F+++WSLN FALIVLNFLEKPLWCAK TYSC DREYY+LG
Sbjct: 57 DQESFESAAKFYFIFIRFNFLWSLNLFALIVLNFLEKPLWCAKQT--TYSCNDREYYFLG 114
Query: 126 QLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVY 185
QLPYLT ESL+YEGITLVI+++HTFFPI+YEGS I+WK+ RLKV+ L ILVAD LVY
Sbjct: 115 QLPYLTSVESLIYEGITLVIILLHTFFPISYEGSQIYWKNPLNRLKVILLSILVADLLVY 174
Query: 186 GLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFS 245
LYLSP+ F +LP R+APYIRV+ ILNIR++R T+ +LAGMLGTYLN++ALGLLFLLF+
Sbjct: 175 VLYLSPLPFYYLPFRLAPYIRVILCILNIREVRATMVILAGMLGTYLNIMALGLLFLLFA 234
Query: 246 SWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVL 305
SW+AYV+FEDT QG VFTS+ TTLYQMF+LFTTSNNPDVWIPAYK SRWYCLFFVLY+L
Sbjct: 235 SWVAYVMFEDTQQGKTVFTSYLTTLYQMFILFTTSNNPDVWIPAYKVSRWYCLFFVLYML 294
Query: 306 IGVYFVTNLILAVVYDSFKSQLAKQVSEMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKL 365
+GVYF+TNLILAV+YDSFK+QLAKQV+EMDRMRRR L KAFNLID N+GFL KEQCI L
Sbjct: 295 LGVYFMTNLILAVIYDSFKNQLAKQVAEMDRMRRRILEKAFNLIDKSNLGFLKKEQCIHL 354
Query: 366 FEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFEN 425
FEELNKYR+LP ISRE+FELIFDELDD++DFKINLDEF DLCNAI L FQKED S FE
Sbjct: 355 FEELNKYRSLPKISREDFELIFDELDDSNDFKINLDEFFDLCNAITLSFQKEDSQSWFER 414
Query: 426 LPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTVWLE 471
PS YHSP EKLKAF+RS+ FG MI++IL++NLVAVI+ETT+ +E
Sbjct: 415 YPSFYHSPACEKLKAFVRSSIFGNMIAVILVLNLVAVIIETTLDIE 460
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302143292|emb|CBI21853.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|197215947|gb|ACH53197.1| two pore channel 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553747|ref|XP_002517914.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] gi|223542896|gb|EEF44432.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449438094|ref|XP_004136825.1| PREDICTED: two pore calcium channel protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449479156|ref|XP_004155521.1| PREDICTED: two pore calcium channel protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297813953|ref|XP_002874860.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] gi|297320697|gb|EFH51119.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18412295|ref|NP_567258.1| two pore calcium channel protein 1 [Arabidopsis thaliana] gi|75166464|sp|Q94KI8.1|TPC1_ARATH RecName: Full=Two pore calcium channel protein 1; AltName: Full=Calcium channel protein 1; Short=AtCCH1; AltName: Full=Fatty acid oxygenation up-regulated protein 2; AltName: Full=Voltage-dependent calcium channel protein TPC1; Short=AtTPC1 gi|13786069|gb|AAK39554.1|AF360372_1 putative calcium channel [Arabidopsis thaliana] gi|222422931|dbj|BAH19452.1| AT4G03560 [Arabidopsis thaliana] gi|332656937|gb|AEE82337.1| two pore calcium channel protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224121708|ref|XP_002330633.1| predicted protein [Populus trichocarpa] gi|222872237|gb|EEF09368.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|14041819|dbj|BAB55460.1| two-pore calcium channel [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 494 | ||||||
| TAIR|locus:2128716 | 733 | TPC1 "two-pore channel 1" [Ara | 0.884 | 0.596 | 0.626 | 1.1e-142 | |
| UNIPROTKB|I3LAZ6 | 309 | LOC100620627 "Uncharacterized | 0.433 | 0.692 | 0.280 | 8.3e-21 | |
| UNIPROTKB|J9JHA5 | 773 | TPC3 "Uncharacterized protein" | 0.661 | 0.423 | 0.253 | 1e-20 | |
| UNIPROTKB|C4IXV8 | 768 | TPC3 "Uncharacterized protein" | 0.657 | 0.423 | 0.246 | 2.3e-20 | |
| UNIPROTKB|E1BXD3 | 587 | E1BXD3 "Uncharacterized protei | 0.394 | 0.332 | 0.289 | 8.8e-15 | |
| UNIPROTKB|F1NNJ8 | 569 | F1NNJ8 "Uncharacterized protei | 0.382 | 0.332 | 0.278 | 1.8e-14 | |
| UNIPROTKB|E2QYG4 | 751 | TPCN2 "Uncharacterized protein | 0.688 | 0.452 | 0.25 | 8.3e-14 | |
| DICTYBASE|DDB_G0289105 | 2060 | DDB_G0289105 "two-pore calcium | 0.421 | 0.100 | 0.266 | 1.5e-13 | |
| UNIPROTKB|F1MSJ0 | 793 | TPCN1 "Uncharacterized protein | 0.601 | 0.374 | 0.212 | 9e-13 | |
| UNIPROTKB|B7Z3R2 | 748 | TPCN1 "Two pore calcium channe | 0.601 | 0.397 | 0.212 | 1.8e-12 |
| TAIR|locus:2128716 TPC1 "two-pore channel 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1395 (496.1 bits), Expect = 1.1e-142, P = 1.1e-142
Identities = 275/439 (62%), Positives = 322/439 (73%)
Query: 33 RRTDAITRGSPYQKAAALVDLAEDGIGLPEEILDRSSFESSAXXXXXXXXXXXXWSLNYF 92
RR++AIT G+P+QKAAALVDLAEDGIGLP EILD+SSF SA WSLNYF
Sbjct: 20 RRSEAITHGTPFQKAAALVDLAEDGIGLPVEILDQSSFGESARYYFIFTRLDLIWSLNYF 79
Query: 93 ALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFF 152
AL+ LNF E+PLWC K SC DR+YYYLG+LPYLT ES++YE ITL IL++HTFF
Sbjct: 80 ALLFLNFFEQPLWCEKNPKP--SCKDRDYYYLGELPYLTNAESIIYEVITLAILLVHTFF 137
Query: 153 PITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFIL 212
PI+YEGS IFW S +KV C++IL D LV LYLSP+AF+FLP RIAPY+RV+ FIL
Sbjct: 138 PISYEGSRIFWTSRLNLVKVACVVILFVDVLVDFLYLSPLAFDFLPFRIAPYVRVIIFIL 197
Query: 213 NIRQLRDTLFVLAGMLGTYLNVXXXXXXXXXXXXXXXYVIFEDTVQGNMVFTSFGTTLYQ 272
+IR+LRDTL +L+GMLGTYLN+ +V+FEDT QG VFTS+G TLYQ
Sbjct: 198 SIRELRDTLVLLSGMLGTYLNILALWMLFLLFASWIAFVMFEDTQQGLTVFTSYGATLYQ 257
Query: 273 MFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVS 332
MF+LFTTSNNPDVWIPAYK+SRW +FFVLYVLIGVYFVTNLILAVVYDSFK QLAKQVS
Sbjct: 258 MFILFTTSNNPDVWIPAYKSSRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQVS 317
Query: 333 EMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISRXXXXXXXXXXXX 392
MD+M+RR L KAF LID+ G ++K QCIKLFE+L YRTLP IS+
Sbjct: 318 GMDQMKRRMLEKAFGLIDSDKNGEIDKNQCIKLFEQLTNYRTLPKISKEEFGLIFDELDD 377
Query: 393 THDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMXX 452
T DFKIN DEFADLC AIALRFQKE+VPS FE+ P IYHS S++L+AF+RS FGY
Sbjct: 378 TRDFKINKDEFADLCQAIALRFQKEEVPSLFEHFPQIYHSALSQQLRAFVRSPNFGYAIS 437
Query: 453 XXXXXXXXXXXXETTVWLE 471
ETT+ +E
Sbjct: 438 FILIINFIAVVVETTLDIE 456
|
|
| UNIPROTKB|I3LAZ6 LOC100620627 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JHA5 TPC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C4IXV8 TPC3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXD3 E1BXD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNJ8 F1NNJ8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QYG4 TPCN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0289105 DDB_G0289105 "two-pore calcium channel protein 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSJ0 TPCN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z3R2 TPCN1 "Two pore calcium channel protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 494 | |||
| pfam00520 | 194 | pfam00520, Ion_trans, Ion transport protein | 3e-11 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 7e-05 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 9e-04 |
| >gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein | Back alignment and domain information |
|---|
Score = 61.9 bits (151), Expect = 3e-11
Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 14/170 (8%)
Query: 162 FWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTL 221
+++S + L L +L + +++ L L R+ +R++ + LR L
Sbjct: 27 YFRSPWNILDFLVVLPSLVSLILFLLGEDSGLLRVL--RLLRLLRLLRLLRRFPGLRTLL 84
Query: 222 FVLAGMLGTYLNVLALGLLFLLFSSWLAYVIF-----------EDTVQGNMVFTSFGTTL 270
L L + LN+L L LL L + + +F E+ + GN F S+G L
Sbjct: 85 QSLGRSLKSLLNLLLLLLLLLFIFAIIGVQLFGGELDKCCDKNENPINGNSNFDSYGEAL 144
Query: 271 YQMFVLFTTSNNPDVWIPAYKASRWYC-LFFVLYVLIGVYFVTNLILAVV 319
+F TT DV +FFV+++++G + NL++ V+
Sbjct: 145 LWLFRTLTTEGWGDVMYDTLVPGTVLGKIFFVIFIILGGVLLLNLLIGVI 194
|
This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices. Length = 194 |
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 494 | |||
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 100.0 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 100.0 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 100.0 | |
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 99.96 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 99.89 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.87 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 99.86 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.69 | |
| PF08016 | 425 | PKD_channel: Polycystin cation channel; InterPro: | 99.63 | |
| KOG3599 | 798 | consensus Ca2+-modulated nonselective cation chann | 99.63 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 99.34 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.22 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 98.96 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.51 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.21 | |
| KOG3614 | 1381 | consensus Ca2+/Mg2+-permeable cation channels (LTR | 97.81 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 97.76 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 97.63 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 97.6 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 97.52 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 97.35 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 97.35 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 97.24 | |
| KOG3533 | 2706 | consensus Inositol 1,4,5-trisphosphate receptor [S | 97.11 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 97.1 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 97.08 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 97.04 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 97.03 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 97.03 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 96.92 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 96.79 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 96.71 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 96.69 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 96.63 | |
| PTZ00184 | 149 | calmodulin; Provisional | 96.6 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 96.58 | |
| PTZ00183 | 158 | centrin; Provisional | 96.56 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 96.42 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 96.41 | |
| KOG3733 | 566 | consensus Mucolipidin and related proteins (TRML s | 96.37 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 96.11 | |
| PTZ00184 | 149 | calmodulin; Provisional | 96.09 | |
| PTZ00183 | 158 | centrin; Provisional | 95.85 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 95.8 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 95.72 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 95.68 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 95.6 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 95.55 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 95.31 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 94.9 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 94.83 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 94.56 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 94.4 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 94.37 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 94.17 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 94.13 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 93.86 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 93.28 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 92.71 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 92.6 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 92.37 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 92.33 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 92.17 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 92.15 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 92.12 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 91.58 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 91.34 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 90.22 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 90.15 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 89.95 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 89.05 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 88.79 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 85.72 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 85.45 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 85.31 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 84.88 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 83.03 |
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-37 Score=328.15 Aligned_cols=285 Identities=20% Similarity=0.285 Sum_probs=236.9
Q ss_pred HHHHHHHHHHHHHHHHhhccc----chhhccccccchhHHHHHHHHHHHHHHhhcC--CcCCcchhhhHhHHHHHHHHhc
Q 011091 139 EGITLVILIIHTFFPITYEGS----PIFWKSTYTRLKVLCLLILVADFLVYGLYLS--PIAFNFLPLRIAPYIRVVFFIL 212 (494)
Q Consensus 139 E~i~l~iF~~E~~lk~~~~g~----~~y~~~~wN~~d~ivvv~~~id~i~~~~~~~--~~~~~~~~lR~~R~lR~lrli~ 212 (494)
+.+|++||.+|+.+|+++.|+ ..|+++.||.+|.+++.++++|+++...... ......+++|.+|.+||+|.|+
T Consensus 1162 nyIFtaIfV~Em~lKVVALGl~fge~aYl~ssWN~LDgflv~vsviDilvs~asa~g~kILgVlrvLRlLRtlRpLRviS 1241 (1956)
T KOG2302|consen 1162 NYIFTAIFVVEMTLKVVALGLYFGEQAYLRSSWNVLDGFLVAVSVIDILVSQASAGGAKILGVLRVLRLLRTLRPLRVIS 1241 (1956)
T ss_pred chHHHHHHHHHHHHHHHhhhhccchHHHHHHHHHhhhHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHhhHHHHHh
Confidence 689999999999999999885 6799999999999999999999988765321 1112457788889999999999
Q ss_pred ccHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc--------------------c-----cccccCcHH
Q 011091 213 NIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTV--------------------Q-----GNMVFTSFG 267 (494)
Q Consensus 213 ~~~~lr~l~~~l~~sl~~i~~v~~ll~l~~~ifAilg~~lF~~~~--------------------~-----g~~~F~~~~ 267 (494)
+-++++.++.++..|+|+|++++++++-++++|+++|+|+|.|+. + ...||+|.+
T Consensus 1242 ra~glklVveTL~sSLkpIgnIvliccaffiiFgilgvqLFkgkfy~c~g~dtrnitnKSdc~aa~yRwvrhkyNfdnlg 1321 (1956)
T KOG2302|consen 1242 RAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNKSDCMAAPYRWVRHKYNFDNLG 1321 (1956)
T ss_pred hcccHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHHHHhcccceeccccccccccchhhhcccchhhhhhhcccchHH
Confidence 999999999999999999999999999999999999999999742 0 146899999
Q ss_pred HHHHHHHhHhccCCCchhhH-----------hhhhcCcchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 011091 268 TTLYQMFVLFTTSNNPDVWI-----------PAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEMDR 336 (494)
Q Consensus 268 ~s~~tLf~l~Tt~~w~dvm~-----------p~~~~~~~~~ifFi~~iii~~~illNLfiAVI~~~F~~~~~~~~~~~~~ 336 (494)
+|+++||++.|-+||.+||| |..++|+|..+|||+|.+|..|+++|||++|+.+||.+.++++.+++..
T Consensus 1322 qalmSLFvLaSkDgWv~ImyDgldavavdqqPI~nhnpwmllYfIsfllIvsffVlnmfVgvvvenfhKcrqhqe~EeAr 1401 (1956)
T KOG2302|consen 1322 QALMSLFVLASKDGWVNIMYDGLDAVAVDQQPILNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEAR 1401 (1956)
T ss_pred HHHHHHHHHhcccchhhhhccchhhceeeeeccccCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999996 5567899999999999999999999999999999999988777655444
Q ss_pred HHHHHHHHHHHhhccCCCcccCHHHHHHHHHHhhcccCCCCCCHHHHHHHHHHhcccCCCccCHHHHHHHHHHHhhhhcc
Q 011091 337 MRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQK 416 (494)
Q Consensus 337 ~rr~~l~~af~~L~~~~~g~l~~~~~~~l~~~l~~~~~~p~~~~~~~~~lf~~ld~~~~~~I~~~eF~~l~~~i~~~~~~ 416 (494)
+|.++ +++.+.+.+ .+.
T Consensus 1402 RreEK-----------------------rLrrlekkr----------------------------------------R~A 1418 (1956)
T KOG2302|consen 1402 RREEK-----------------------RLRRLEKKR----------------------------------------RAA 1418 (1956)
T ss_pred HHHHH-----------------------HHHHHHHHH----------------------------------------Hhc
Confidence 33322 122221100 011
Q ss_pred cCCccccccCCCCcccHHHHHHHhcccccchhHHHHHHHHHHHHHHHHhhccc-------hhhhhHHHHHHHHHHHHHHH
Q 011091 417 EDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTVW-------LEFIDSNFLCLFLINICDIC 489 (494)
Q Consensus 417 ~~~~~~~~~~P~~y~s~~~~~l~~~v~~~~F~~~i~~iillN~i~l~~e~~~~-------~~~~~~~F~~iF~~Ei~~~~ 489 (494)
++.|-+ .. .+..++.+++.+.+.|-+.++.++|.+|.|.++.|++.+ +.+.||.|+++|+.|+.+|.
T Consensus 1419 q~kpyy-----se-yt~~rrlIh~~ctShyld~fit~ii~LnvVtms~ehyqqp~sldealkycny~ft~vfV~EaV~kl 1492 (1956)
T KOG2302|consen 1419 QRKPYY-----SE-YTMTRRLIHSKCTSHYLDQFITFIICLNVVTMSEEHYQQPTSLDEALKYCNYRFTAVFVLEAVLKL 1492 (1956)
T ss_pred cCCccc-----cc-ccHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHhCcccHHHHhhhcceeeeehhHHHHHHHH
Confidence 222221 12 366889999999999999999999999999999999855 45999999999999999998
Q ss_pred hhc
Q 011091 490 LNK 492 (494)
Q Consensus 490 ~~~ 492 (494)
.+.
T Consensus 1493 vaf 1495 (1956)
T KOG2302|consen 1493 VAF 1495 (1956)
T ss_pred HHH
Confidence 764
|
|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys | Back alignment and domain information |
|---|
| >KOG3599 consensus Ca2+-modulated nonselective cation channel polycystin [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG3614 consensus Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3533 consensus Inositol 1,4,5-trisphosphate receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3733 consensus Mucolipidin and related proteins (TRML subfamily of transient receptor potential proteins) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 494 | |||
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 8e-13 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 6e-12 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 2e-05 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 3e-04 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 5e-04 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 5e-04 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 6e-04 |
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 3rw0_A* Length = 285 | Back alignment and structure |
|---|
Score = 67.8 bits (166), Expect = 8e-13
Identities = 32/144 (22%), Positives = 69/144 (47%), Gaps = 3/144 (2%)
Query: 181 DFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLL 240
DF V + L P + F LR+ +R+ + + Q+R + L ++ L+V+AL L
Sbjct: 98 DFFVVAISLVPTSSGFEILRVLRVLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTL 157
Query: 241 FLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSN-NPDVWIPAYKASRWYCLF 299
F + +A +F + F + G + Y +F + T + + + P + + +F
Sbjct: 158 FFYIFAIMATQLFGERFPEW--FGTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVF 215
Query: 300 FVLYVLIGVYFVTNLILAVVYDSF 323
F+ ++ + + + NL++A+ D+
Sbjct: 216 FIPFIFVVTFVMINLVVAICVDAM 239
|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Length = 229 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 494 | |||
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 100.0 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 100.0 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.88 | |
| 4f4l_A | 112 | ION transport protein; alpha helical membrane prot | 99.87 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.72 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.52 | |
| 1ors_C | 132 | Potassium channel; voltage-dependent, voltage sens | 99.09 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 98.4 | |
| 2kyh_A | 147 | KVAP, voltage-gated potassium channel; ION channel | 98.22 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 98.12 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 98.09 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.05 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.01 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.01 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 97.95 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 97.83 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 97.82 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 97.82 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 97.79 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 97.78 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 97.77 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 97.74 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 97.72 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 97.71 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 97.7 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 97.69 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 97.69 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 97.69 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 97.66 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.65 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 97.65 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 97.64 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 97.63 | |
| 1ors_C | 132 | Potassium channel; voltage-dependent, voltage sens | 97.6 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 97.59 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 97.58 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 97.58 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 97.57 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 97.57 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 97.56 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 97.56 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 97.52 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 97.51 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 97.51 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 97.5 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 97.49 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 97.49 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 97.47 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 97.45 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 97.45 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 97.44 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 97.44 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 97.44 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 97.43 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 97.42 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 97.42 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 97.42 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 97.41 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 97.41 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 97.4 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 97.39 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 97.39 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 97.37 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 97.36 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 97.36 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 97.36 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 97.34 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 97.34 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 97.33 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 97.3 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 97.3 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 97.29 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 97.25 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 97.23 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 97.23 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 97.22 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 97.21 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 97.21 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 97.2 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 97.2 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 97.19 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 97.19 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 97.19 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 97.18 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 97.16 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 97.15 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 97.14 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 97.12 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 97.12 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 97.12 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 97.11 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 97.11 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 97.1 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 97.1 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 97.09 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 97.08 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 97.08 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 97.08 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 97.07 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 97.07 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 97.06 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 97.04 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 97.03 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 97.01 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 97.01 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 97.0 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 97.0 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 97.0 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 96.99 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 96.98 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 96.97 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 96.96 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 96.95 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 96.94 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 96.94 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 96.94 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 96.94 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 96.93 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 96.93 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 96.92 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 96.91 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 96.9 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 96.89 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 96.88 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 96.88 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 96.86 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 96.84 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 96.82 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 96.82 | |
| 2kyh_A | 147 | KVAP, voltage-gated potassium channel; ION channel | 96.8 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 96.79 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 96.78 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 96.78 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 96.77 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 96.75 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 96.75 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 96.74 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 96.72 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 96.71 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 96.7 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 96.7 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 96.67 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 96.66 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 96.65 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 96.64 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 96.64 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 96.63 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 96.62 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 96.6 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 96.6 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 96.59 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 96.58 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 96.57 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 96.57 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 96.53 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 96.52 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 96.51 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 96.51 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 96.5 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 96.49 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 96.44 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 96.43 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 96.41 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 96.4 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 96.4 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 96.38 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 96.37 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 96.36 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 96.36 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 96.34 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 96.33 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 96.32 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 96.32 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 96.31 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 96.31 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 96.31 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 96.3 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 96.3 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 96.29 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 96.29 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 96.28 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 96.27 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 96.27 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 96.26 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 96.26 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 96.26 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 96.26 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 96.24 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 96.19 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 96.19 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 96.19 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 96.18 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 96.17 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 96.14 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 96.13 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 96.08 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 96.0 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 96.0 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 95.99 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 95.99 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 95.99 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 95.99 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 95.98 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 95.95 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 95.93 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 95.88 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 95.83 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 95.82 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 95.81 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 95.8 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 95.73 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 95.69 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 95.65 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 95.64 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 95.61 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 95.61 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 95.59 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 95.58 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 95.56 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 95.55 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 95.44 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 95.43 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 95.39 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 95.38 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 95.34 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 95.33 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 95.29 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 95.18 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 95.11 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 95.02 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 95.0 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 94.97 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 94.93 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 94.83 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 94.79 | |
| 1qg9_A | 26 | Protein (sodium channel protein, brain II alpha su | 94.74 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 94.72 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 94.71 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 94.68 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 94.68 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 94.43 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 94.35 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 94.22 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 94.22 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 94.1 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 93.9 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 93.89 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 93.88 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.87 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 93.81 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 93.78 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 93.78 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 93.63 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 93.6 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 93.54 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 93.53 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 93.49 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 93.3 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 93.28 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 93.26 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 93.23 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 93.18 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 93.1 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 92.98 | |
| 2lcm_A | 28 | Voltage-dependent N-type calcium channel subunit; | 92.98 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 92.91 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 92.75 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 92.53 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 92.45 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 92.43 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 92.18 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 91.98 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 91.86 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 91.84 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 91.66 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 91.44 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 91.32 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 90.43 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 90.08 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 89.05 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 88.88 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 88.75 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 88.42 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 87.09 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 86.92 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 86.03 | |
| 1qg9_A | 26 | Protein (sodium channel protein, brain II alpha su | 85.21 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 82.23 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 80.64 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 80.48 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 80.28 |
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.3e-35 Score=281.54 Aligned_cols=180 Identities=18% Similarity=0.307 Sum_probs=156.7
Q ss_pred HHHHHHHHHHHHHHHHHHhhcc-cchhhccccccchhHHHHHHHHHHHHHHhhcCCcCCcchhhhHhHHHHHHHHhcccH
Q 011091 137 VYEGITLVILIIHTFFPITYEG-SPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIR 215 (494)
Q Consensus 137 i~E~i~l~iF~~E~~lk~~~~g-~~~y~~~~wN~~d~ivvv~~~id~i~~~~~~~~~~~~~~~lR~~R~lR~lrli~~~~ 215 (494)
.+|.+|+++|++|+++|+++.| +++|++++||++|++++++++++.... ...+.+|.+|++|++|+++.++
T Consensus 46 ~~e~~~~~iF~~E~~lri~~~~~~~~y~~~~wni~D~~~v~~~~i~~~~~--------~~~~~lr~~RilR~lrl~~~~~ 117 (229)
T 4dxw_A 46 LLDYGITIFFVIEILIRFIGEKQKADFFKSGWNIFDTVIVAISLIPIPNN--------SSFLVLRLLRIFRVLRLISVIP 117 (229)
T ss_dssp HHHHHHHHHHHHHHHHHHHC---------CHHHHHHHHHHHHTTCC----------------CCTTHHHHHHTTHHHHCH
T ss_pred HHHHHHHHHHHHHHHHHHHHcCchhHHhcCCcHHHHHHHHHHHHhhcCcc--------HHHHHHHHHHHHHHHHHHHHhH
Confidence 4799999999999999999986 578999999999999998887654211 2346779999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccCcHHHHHHHHHhHhccCCCchhhHhhhhcCcc
Q 011091 216 QLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRW 295 (494)
Q Consensus 216 ~lr~l~~~l~~sl~~i~~v~~ll~l~~~ifAilg~~lF~~~~~g~~~F~~~~~s~~tLf~l~Tt~~w~dvm~p~~~~~~~ 295 (494)
++|.+.+++.++.|+++++++++++++++||++|+++|++..+ .+|+|+++|++++|+++|+|||+|+|+++++.++|
T Consensus 118 ~l~~l~~~l~~s~~~l~~~~~~l~~~~~ifa~~g~~lf~~~~~--~~F~~~~~a~~~lf~~~t~~~w~~i~~~~~~~~~~ 195 (229)
T 4dxw_A 118 ELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDP--SRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWW 195 (229)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTSC--TTTSSHHHHHHHHHHHHTTSSTHHHHHHHHTTCTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCc--ccccCHHHHHHHHHHHHccCCHHHHHHHHHHhCCc
Confidence 9999999999999999999999999999999999999999764 68999999999999999999999999999999999
Q ss_pred hhhhhhhHHHHHHHHHHHHHHHHHHHHHHHH
Q 011091 296 YCLFFVLYVLIGVYFVTNLILAVVYDSFKSQ 326 (494)
Q Consensus 296 ~~ifFi~~iii~~~illNLfiAVI~~~F~~~ 326 (494)
+++||++|+++++++++||++|+++|||++.
T Consensus 196 ~~~~f~~~~~i~~~i~lNlfiavi~~~f~~~ 226 (229)
T 4dxw_A 196 SWVYFFSFIIICSITILNLVIAILVDVVIQK 226 (229)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999865
|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >4f4l_A ION transport protein; alpha helical membrane protein, voltage-gated sodium channel membrane, metal transport; 3.49A {Magnetococcus marinus} | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1qg9_A Protein (sodium channel protein, brain II alpha subunit); transmembrane sodium channel, structure, transmembrane channel; NMR {Synthetic} SCOP: j.35.1.1 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2lcm_A Voltage-dependent N-type calcium channel subunit; voltage sensor peptide, membrane protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 494 | ||||
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 1e-06 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 3e-06 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 5e-06 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 6e-06 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 6e-06 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 7e-06 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 2e-05 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 2e-05 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 3e-05 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 3e-05 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 6e-05 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 8e-05 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 8e-05 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 9e-05 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 9e-05 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 1e-04 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 2e-04 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-04 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-04 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 0.001 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 0.001 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.002 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 0.002 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 0.002 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 0.002 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.003 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 0.003 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 0.004 |
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Caltractin (centrin 2) species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
Score = 44.1 bits (104), Expect = 1e-06
Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
Query: 335 DRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTH 394
+R R + KAF L D+ N G + + ++ +EL + N++ EE + + E D
Sbjct: 4 ERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGE-----NLTEEELQEMIAEADRND 58
Query: 395 DFKINLDEFADL 406
D +I+ DEF +
Sbjct: 59 DNEIDEDEFIRI 70
|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 494 | |||
| d1orsc_ | 132 | Potassium channel KVAP {Archaeon Aeropyrum pernix | 99.0 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.21 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.14 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.1 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.09 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.07 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.03 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.01 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.0 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 97.99 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.98 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 97.98 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.96 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 97.96 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 97.91 | |
| d1orsc_ | 132 | Potassium channel KVAP {Archaeon Aeropyrum pernix | 97.87 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 97.84 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 97.83 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 97.82 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 97.79 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 97.79 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 97.77 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 97.74 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 97.74 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 97.72 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 97.63 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 97.6 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 97.58 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 97.56 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 97.55 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.55 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 97.51 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 97.51 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 97.49 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 97.44 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.38 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 97.36 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 97.33 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 97.3 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 97.27 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 97.26 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 97.25 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 97.22 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 97.2 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 97.19 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 97.17 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 97.11 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 97.1 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 96.95 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 96.93 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 96.93 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 96.89 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 96.87 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 96.84 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 96.7 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 96.7 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 96.69 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 96.68 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 96.68 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 96.61 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 96.5 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 96.46 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 96.46 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 96.45 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 96.44 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 96.4 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 96.27 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 96.23 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 96.13 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 96.12 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 96.11 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 96.03 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 96.01 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 95.9 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 95.88 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 95.82 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 95.78 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 95.75 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 95.7 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.65 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 95.62 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.55 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 95.41 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 95.4 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 95.31 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 95.28 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 95.23 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 95.0 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 94.94 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 94.91 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 94.83 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 94.68 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 94.49 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 94.44 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 94.43 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 94.39 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 94.34 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 94.3 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 94.28 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 94.17 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 94.05 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 93.98 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 93.75 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 93.72 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 93.48 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 93.41 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 93.33 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 93.11 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 93.05 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 92.56 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 92.29 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 92.23 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 92.07 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 91.76 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 91.45 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 91.39 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 91.25 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 91.21 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 89.67 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 89.22 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 88.77 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 88.67 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 85.52 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 84.07 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 84.03 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 83.78 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 82.74 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 82.25 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 82.04 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 80.79 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 80.71 |
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel KVAP species: Archaeon Aeropyrum pernix [TaxId: 56636]
Probab=99.00 E-value=3.8e-10 Score=96.96 Aligned_cols=89 Identities=17% Similarity=0.120 Sum_probs=75.3
Q ss_pred HHHHHHHHHHHHHHHHHHhhcccchhhccccccchhHHHHHHHHHHHHHHhhcCCcCCcchhhhHhHHHHHHHHhcccHh
Q 011091 137 VYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQ 216 (494)
Q Consensus 137 i~E~i~l~iF~~E~~lk~~~~g~~~y~~~~wN~~d~ivvv~~~id~i~~~~~~~~~~~~~~~lR~~R~lR~lrli~~~~~ 216 (494)
.+|.+|+++|++|+++|+++.|.+ |....||++|++.++.+++........ ...+.+|.+|++|.+|+++..++
T Consensus 41 ~~e~v~~~iF~~E~~lrl~~~~~~-~~~~~~~~iDl~ai~p~~~~~~~~~~~-----~~lr~lR~~R~~R~lrl~~~~~~ 114 (132)
T d1orsc_ 41 LVDLILVIILWADYAYRAYKSGDP-AGYVKKTLYEIPALVPAGLLALIEGHL-----AGLGLFRLVRLLRFLRILLIISR 114 (132)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTTST-TTTTTTCGGGTGGGSCHHHHHHHHHHH-----HHTTCHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhCCcc-ceeCCcchHHHHHHHHHHHHHhhhhhH-----HHHHHHHHHHHHHHHHHHHHHHH
Confidence 579999999999999999988754 666789999999998887765544221 25678999999999999999999
Q ss_pred HHHHHHHHHHHHHHH
Q 011091 217 LRDTLFVLAGMLGTY 231 (494)
Q Consensus 217 lr~l~~~l~~sl~~i 231 (494)
++++++++.+|.+++
T Consensus 115 ~~~ll~ai~~s~~~l 129 (132)
T d1orsc_ 115 GSKFLSAIADAADKL 129 (132)
T ss_dssp HHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHhh
Confidence 999999999999876
|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|