Citrus Sinensis ID: 011119

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
cEEEEEccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEccccEEEEEEEEEccccccHHHHHHEEEccccEEccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccHHHHcccccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcEEccccc
cEEEEEcccEEcccccccccccEEccccccccccHHHHHccccccEEEEEEHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHHHccccccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccHHHHccccccccccccEEEEccccccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHcccHccHHHHHcccccccEEEHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccEcHHHHHEHcccccHHHHHHHHHccccccccccHHHEEEEEcccccccHccccccccccccccccccEEcEEEEEEEEccHHHHcccccccccccccccEEEEEccEEccccc
MVAVVdsnnlsipnlntngnesrvgykrsvprsnsgyvssimgecciscttfniLAPIYKrldhqnqslresdvrdswfNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERlgnagyntfslartnnrgdgLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVvpffqnqgggqqEILIVNThllfphdsslsvvRLHQVYKILQYLELYQTenklnhipiilcgdwngskrghVYKFLRsqgfvssydvahqytdgdadahkwvshrnhrgnicgvdfiwlrnpnqsrkplqASWAEAVFSIIKCQLQKASLAENDAFaffkadnngdviTHSAFCEALRQVNLaglpyglsfqetddlwaqadvdgngvvnyeeFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENncndnmedskdcsekeiLGFAvkdaflfpsevekgkwpenyslsdhaplsvvfspvrmqsss
mvavvdsnnlsipnlntngnesrvgykrsvPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLresdvrdswfNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPenyslsdhaplsvvfspvrmqsss
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
***********************************GYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNC***********EKEILGFAVKDAFLFPSEVEKGKWPENYSL*******************
*VAVV*****************************************ISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQ*TDG*ADAHKWVSHRNHRGNICGVDFIWLRNPNQS**********AVFSIIKCQLQ***LA***AFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSA*********************LGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFS********
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCS******************EKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query493 2.2.26 [Sep-21-2011]
O81916484 Uncharacterized calcium-b yes no 0.866 0.882 0.636 1e-169
Q24239354 Protein angel OS=Drosophi yes no 0.326 0.454 0.288 8e-09
Q9LS39448 Carbon catabolite repress no no 0.320 0.352 0.297 5e-08
Q8W0Z9602 Carbon catabolite repress no no 0.302 0.247 0.265 6e-08
Q0WKY2454 Carbon catabolite repress no no 0.395 0.429 0.248 7e-07
Q8VYU4 754 Carbon catabolite repress no no 0.330 0.216 0.241 1e-06
Q9M2F8603 Carbon catabolite repress no no 0.306 0.250 0.273 3e-06
Q5VTE6544 Protein angel homolog 2 O yes no 0.330 0.299 0.235 0.0002
Q5RGT6569 Protein angel homolog 2 O no no 0.334 0.289 0.227 0.0002
P79942388 Nocturnin OS=Xenopus laev N/A no 0.399 0.507 0.248 0.0007
>sp|O81916|YC22_ARATH Uncharacterized calcium-binding protein At1g02270 OS=Arabidopsis thaliana GN=At1g02270 PE=2 SV=2 Back     alignment and function desciption
 Score =  593 bits (1529), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/462 (63%), Positives = 346/462 (74%), Gaps = 35/462 (7%)

Query: 29  SVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDW 88
           SV R NS   SS M E  ISCTTFNILAPIYKR+D +N S RESD R  W  RNQ ILD 
Sbjct: 54  SVMRLNSNLASS-MVESNISCTTFNILAPIYKRVDQKNHSTRESDFRTLWLARNQRILDL 112

Query: 89  LICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNV 148
           L+ +RSSVICLQE WVGNEELV MY  +L ++GY  + LARTN+RGDGLLTA+H+D+F V
Sbjct: 113 LLHQRSSVICLQEVWVGNEELVNMYHHQLSSSGYTIYQLARTNSRGDGLLTAIHKDHFKV 172

Query: 149 LNYRELLFNDFGDRVAQLVHVESVVPFFQN-QGGGQQEILIVNTHLLFPHDSSLSVVRLH 207
           +NYRELLFNDFGDRVAQL+HV++V+PF  N +   QQE++IVNTHLLFPHDSSLS+VRLH
Sbjct: 173 VNYRELLFNDFGDRVAQLLHVKTVIPFPLNGKQDVQQEVIIVNTHLLFPHDSSLSIVRLH 232

Query: 208 QVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGD 267
           QVYKIL+YLE YQ ENKLNH+PIILCGDWNGSKRGHVYKFLRSQGF+SSYD AHQYT  D
Sbjct: 233 QVYKILEYLEAYQKENKLNHMPIILCGDWNGSKRGHVYKFLRSQGFISSYDDAHQYT--D 290

Query: 268 ADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDA 327
           +DAH+WVSHRNHRGNICGVDFIWL NP+ SRKPL+ SW EAVFSIIK QL KAS+AE+DA
Sbjct: 291 SDAHRWVSHRNHRGNICGVDFIWLCNPSDSRKPLRTSWVEAVFSIIKYQLHKASIAEDDA 350

Query: 328 FAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFK 387
           F F  A N+ D +T+S FC AL++VNL G+P+GLSF+ET +LW +AD+DGNGV +YEE K
Sbjct: 351 FTFLGAKNHSDSLTYSDFCLALQKVNLTGIPHGLSFEETKELWVRADLDGNGVFDYEELK 410

Query: 388 VHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSEKE 447
                                          ++WN++   Q  N     ME  K+  E E
Sbjct: 411 -------------------------------KIWNMTMVNQPGNCKESVMESKKEEGEDE 439

Query: 448 ILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRM 489
            +G  V  A LFP E EKG WPENY++SDHA L+V FSPV+M
Sbjct: 440 AIGLKVNKAILFPQEAEKGLWPENYNISDHACLTVQFSPVKM 481

Arabidopsis thaliana (taxid: 3702)
>sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster GN=angel PE=1 SV=2 Back     alignment and function description
>sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2 Back     alignment and function description
>sp|Q8W0Z9|CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana GN=CCR4-1 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2 Back     alignment and function description
>sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2F8|CCR4B_ARATH Carbon catabolite repressor protein 4 homolog 2 OS=Arabidopsis thaliana GN=CCR4-2 PE=2 SV=2 Back     alignment and function description
>sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio GN=angel2 PE=2 SV=1 Back     alignment and function description
>sp|P79942|NOCT_XENLA Nocturnin OS=Xenopus laevis GN=ccrn4l PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
255548127471 carbon catabolite repressor protein, put 0.922 0.966 0.690 0.0
224130716429 predicted protein [Populus trichocarpa] 0.849 0.976 0.708 0.0
296089038485 unnamed protein product [Vitis vinifera] 0.851 0.865 0.703 0.0
225453682431 PREDICTED: uncharacterized calcium-bindi 0.847 0.969 0.704 1e-180
356559426473 PREDICTED: uncharacterized calcium-bindi 0.874 0.911 0.633 1e-168
225455177451 PREDICTED: uncharacterized calcium-bindi 0.835 0.913 0.658 1e-168
147837828445 hypothetical protein VITISV_034892 [Viti 0.835 0.925 0.658 1e-168
297848430484 endonuclease/exonuclease/phosphatase fam 0.872 0.888 0.636 1e-167
18378941484 uncharacterized calcium-binding protein 0.866 0.882 0.636 1e-167
356522458477 PREDICTED: uncharacterized calcium-bindi 0.845 0.874 0.642 1e-166
>gi|255548127|ref|XP_002515120.1| carbon catabolite repressor protein, putative [Ricinus communis] gi|223545600|gb|EEF47104.1| carbon catabolite repressor protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/504 (69%), Positives = 392/504 (77%), Gaps = 49/504 (9%)

Query: 1   MVAVVDSNNLSIPNLNTNGNES-------RVGYKRSVPRSNSGYVSS--IMGECCISCTT 51
           MVAVV+SN       N+ GNE+             +V R++SG++SS  ++ E CISCTT
Sbjct: 1   MVAVVESNG------NSGGNEANNVLNGITTAAAAAVSRTSSGFLSSTTMLDEPCISCTT 54

Query: 52  FNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVL 111
           FNILAPIYKRLDHQNQS+RESD R  WF RNQ ILDWL+ ERSS+ICLQEFWVGNEELV 
Sbjct: 55  FNILAPIYKRLDHQNQSIRESDFRAFWFTRNQRILDWLLYERSSIICLQEFWVGNEELVR 114

Query: 112 MYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVES 171
           MY+ERLG+AGY TF LARTNNRGDGLLTA+H+DYF VLNY+ELLFNDFGDRVAQL+HV+S
Sbjct: 115 MYEERLGDAGYITFQLARTNNRGDGLLTAVHKDYFTVLNYQELLFNDFGDRVAQLLHVQS 174

Query: 172 VVPFFQNQGGG-QQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPI 230
            VP  Q Q G  QQE LIVNTHLLFPHDSSLS+VRLHQVYKILQY+E YQ +NKL+H+PI
Sbjct: 175 AVPLLQCQTGDVQQEFLIVNTHLLFPHDSSLSIVRLHQVYKILQYVETYQRDNKLSHMPI 234

Query: 231 ILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIW 290
           ILCGDWNGSKRGHVYKFLRSQGFVSSYD+AHQYTD DADAHKWVSHRNHRGNICGVDFIW
Sbjct: 235 ILCGDWNGSKRGHVYKFLRSQGFVSSYDIAHQYTDSDADAHKWVSHRNHRGNICGVDFIW 294

Query: 291 LRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALR 350
           LRNPN+S+KPL+ SW EAVF IIKCQL KASL ENDAFAF KAD  GD IT+SAFCE LR
Sbjct: 295 LRNPNKSKKPLKTSWYEAVFGIIKCQLLKASLTENDAFAFLKADEPGDFITYSAFCEGLR 354

Query: 351 QVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESM 410
           QVNL GLPYGLSFQ+T DLW +AD+DGNG+V+YEEFK                       
Sbjct: 355 QVNLIGLPYGLSFQQTKDLWIRADIDGNGIVDYEEFK----------------------- 391

Query: 411 LKLLALQQRMWNLSCSAQIENNCNDNMEDSKDCSE--KEILGFAVKDAFLFPSEVEKGKW 468
                  +R+WN SC  Q E  C  ++ED +   E  +  +GFAVK+A LFP E EKG W
Sbjct: 392 -------ERIWNSSCPEQ-EEQCPGSIEDPEQGKEEGEGAIGFAVKNAVLFPREAEKGLW 443

Query: 469 PENYSLSDHAPLSVVFSPVRMQSS 492
           PENYSLSDHA L+VVFSPVRM SS
Sbjct: 444 PENYSLSDHARLTVVFSPVRMHSS 467

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224130716|ref|XP_002320910.1| predicted protein [Populus trichocarpa] gi|222861683|gb|EEE99225.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089038|emb|CBI38741.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225453682|ref|XP_002268930.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559426|ref|XP_003548000.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Glycine max] Back     alignment and taxonomy information
>gi|225455177|ref|XP_002270121.1| PREDICTED: uncharacterized calcium-binding protein At1g02270 [Vitis vinifera] gi|302144002|emb|CBI23107.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147837828|emb|CAN73791.1| hypothetical protein VITISV_034892 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297848430|ref|XP_002892096.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337938|gb|EFH68355.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18378941|ref|NP_563646.1| uncharacterized calcium-binding protein [Arabidopsis thaliana] gi|148887024|sp|O81916.2|YC22_ARATH RecName: Full=Uncharacterized calcium-binding protein At1g02270 gi|15450673|gb|AAK96608.1| At1g02270/T6A9_9 [Arabidopsis thaliana] gi|17380606|gb|AAL36066.1| At1g02270/T6A9_9 [Arabidopsis thaliana] gi|332189287|gb|AEE27408.1| uncharacterized calcium-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356522458|ref|XP_003529863.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
TAIR|locus:2204863484 AT1G02270 "AT1G02270" [Arabido 0.722 0.735 0.716 8.8e-158
TAIR|locus:2166547436 AT5G54130 [Arabidopsis thalian 0.685 0.775 0.698 1.7e-150
FB|FBgn0016762354 angel "angel" [Drosophila mela 0.326 0.454 0.288 7.3e-08
TAIR|locus:504956231454 AT1G73875 "AT1G73875" [Arabido 0.482 0.524 0.247 1.2e-06
TAIR|locus:2832132 754 AT5G11350 "AT5G11350" [Arabido 0.377 0.246 0.270 1.6e-06
UNIPROTKB|P05419131 P05419 "Neo-calmodulin" [Gallu 0.111 0.419 0.426 0.00026
UNIPROTKB|Q96HY3113 CALM3 "CALM1 protein" [Homo sa 0.111 0.486 0.426 0.00033
TAIR|locus:2204863 AT1G02270 "AT1G02270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1371 (487.7 bits), Expect = 8.8e-158, Sum P(2) = 8.8e-158
 Identities = 258/360 (71%), Positives = 302/360 (83%)

Query:    29 SVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDW 88
             SV R NS   SS++ E  ISCTTFNILAPIYKR+D +N S RESD R  W  RNQ ILD 
Sbjct:    54 SVMRLNSNLASSMV-ESNISCTTFNILAPIYKRVDQKNHSTRESDFRTLWLARNQRILDL 112

Query:    89 LICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNV 148
             L+ +RSSVICLQE WVGNEELV MY  +L ++GY  + LARTN+RGDGLLTA+H+D+F V
Sbjct:   113 LLHQRSSVICLQEVWVGNEELVNMYHHQLSSSGYTIYQLARTNSRGDGLLTAIHKDHFKV 172

Query:   149 LNYRELLFNDFGDRVAQLVHVESVVPFFQN-QGGGQQEILIVNTHLLFPHDSSLSVVRLH 207
             +NYRELLFNDFGDRVAQL+HV++V+PF  N +   QQE++IVNTHLLFPHDSSLS+VRLH
Sbjct:   173 VNYRELLFNDFGDRVAQLLHVKTVIPFPLNGKQDVQQEVIIVNTHLLFPHDSSLSIVRLH 232

Query:   208 QVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGD 267
             QVYKIL+YLE YQ ENKLNH+PIILCGDWNGSKRGHVYKFLRSQGF+SSYD AHQYTD  
Sbjct:   233 QVYKILEYLEAYQKENKLNHMPIILCGDWNGSKRGHVYKFLRSQGFISSYDDAHQYTD-- 290

Query:   268 ADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDA 327
             +DAH+WVSHRNHRGNICGVDFIWL NP+ SRKPL+ SW EAVFSIIK QL KAS+AE+DA
Sbjct:   291 SDAHRWVSHRNHRGNICGVDFIWLCNPSDSRKPLRTSWVEAVFSIIKYQLHKASIAEDDA 350

Query:   328 FAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFK 387
             F F  A N+ D +T+S FC AL++VNL G+P+GLSF+ET +LW +AD+DGNGV +YEE K
Sbjct:   351 FTFLGAKNHSDSLTYSDFCLALQKVNLTGIPHGLSFEETKELWVRADLDGNGVFDYEELK 410
GO:0003824 "catalytic activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
TAIR|locus:2166547 AT5G54130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0016762 angel "angel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:504956231 AT1G73875 "AT1G73875" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832132 AT5G11350 "AT5G11350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P05419 P05419 "Neo-calmodulin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HY3 CALM3 "CALM1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81916YC22_ARATHNo assigned EC number0.63630.86610.8822yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
cd09097329 cd09097, Deadenylase_CCR4, C-terminal deadenylase 1e-08
PLN03144606 PLN03144, PLN03144, Carbon catabolite repressor pr 3e-07
cd09096280 cd09096, Deadenylase_nocturnin, C-terminal deadeny 7e-06
cd08372241 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase 1e-05
COG5239378 COG5239, CCR4, mRNA deadenylase, exonuclease subun 1e-05
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 1e-05
cd09083252 cd09083, EEP-1, Exonuclease-Endonuclease-Phosphata 2e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
cd09078280 cd09078, nSMase, Neutral sphingomyelinases (nSMase 6e-04
cd09079259 cd09079, RgfB-like, Streptococcus agalactiae RgfB, 0.003
cd09073251 cd09073, ExoIII_AP-endo, Escherichia coli exonucle 0.004
>gnl|CDD|197331 cd09097, Deadenylase_CCR4, C-terminal deadenylase domain of CCR4 and related domains Back     alignment and domain information 
 Score = 56.2 bits (136), Expect = 1e-08
 Identities = 53/214 (24%), Positives = 89/214 (41%), Gaps = 43/214 (20%)

Query: 77  SWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTF----SLARTNN 132
           +W  R Q IL  ++   + ++CLQE  V  ++    +   L   GY+      S A+T +
Sbjct: 26  NWDYRKQNILKEILSYNADILCLQE--VETDQYEDFFLPELKQHGYDGVFKPKSRAKTMS 83

Query: 133 RG-----DGLLTALHRDYFNVLNYRELLFN-------------DFGDRV------AQLVH 168
                  DG         F ++    + FN             D  +RV      A +V 
Sbjct: 84  EAERKHVDGCAIFFKTSKFKLVEKHLIEFNQLAMANADAEGSEDMLNRVMTKDNIALIVV 143

Query: 169 VESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQV-------YKILQYLELYQT 221
           +E+    ++   G  Q +++ NTH+ +  +   S V+L Q         KI +    Y  
Sbjct: 144 LEARETSYEGNKG--QLLIVANTHIHWDPE--FSDVKLVQTMMLLEELEKIAEKFSRYPY 199

Query: 222 ENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVS 255
           E+  + IP+++CGD+N      VY+ L S G VS
Sbjct: 200 EDSAD-IPLVVCGDFNSLPDSGVYELL-SNGSVS 231

This subfamily contains the C-terminal catalytic domain of the deadenylases, Saccharomyces cerevisiae Ccr4p and two vertebrate homologs (CCR4a and CCR4b), and related domains. CCR4 belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. CCR4 is the major deadenylase subunit of the CCR4-NOT transcription complex, which contains two deadenylase subunits and several noncatalytic subunits. The other deadenylase subunit, Caf1 (called Pop2 in yeast), is a DEDD-type protein and does not belong in this superfamily. Saccharomyces cerevisiae CCR4 (or Ccr4p) is a 3'-5' poly(A) RNA and ssDNA exonuclease. It is the catalytic subunit of the yeast mRNA deadenylase (Ccr4p/Pop2p/Not complex). This complex participates in various ways in mRNA metabolism, including transcription initiation and elongation, and mRNA degradation. Ccr4p degrades both poly(A) and single-stranded DNA. There are two vertebrate homologs of Ccr4p, CCR4a (also called CCR4-NOT transcription complex subunit 6 or CNOT6) and CCR4b (also called CNOT6-like or CNOT6L), which independently associate with other components to form distinct CCR4-NOT multisubunit complexes. The nuclease domain of CNOT6 and CNOT6L exhibits Mg2+-dependent deadenylase activity, with specificity for poly (A) RNA as substrate. CCR4a is a component of P-bodies and is necessary for foci formation. CCR4b regulates p27/Kip1 mRNA levels, thereby influencing cell cycle progression. They both contribute to the prevention of cell death by regulating insulin-like growth factor-binding protein 5. Length = 329
>gnl|CDD|178689 PLN03144, PLN03144, Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>gnl|CDD|197330 cd09096, Deadenylase_nocturnin, C-terminal deadenylase domain of nocturnin and related domains Back     alignment and domain information
>gnl|CDD|197306 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily Back     alignment and domain information
>gnl|CDD|227564 COG5239, CCR4, mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|197317 cd09083, EEP-1, Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1 Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197312 cd09078, nSMase, Neutral sphingomyelinases (nSMase) catalyze the hydrolysis of sphingomyelin in biological membranes to ceramide and phosphorylcholine Back     alignment and domain information
>gnl|CDD|197313 cd09079, RgfB-like, Streptococcus agalactiae RgfB, part of a putative two component signal transduction system, and related proteins Back     alignment and domain information
>gnl|CDD|197307 cd09073, ExoIII_AP-endo, Escherichia coli exonuclease III (ExoIII)-like apurinic/apyrimidinic (AP) endonucleases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 493
KOG2338495 consensus Transcriptional effector CCR4-related pr 100.0
PLN03144606 Carbon catabolite repressor protein 4 homolog; Pro 100.0
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and rel 99.91
PRK11756268 exonuclease III; Provisional 99.89
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members 99.88
KOG0620361 consensus Glucose-repressible alcohol dehydrogenas 99.83
COG0708261 XthA Exonuclease III [DNA replication, recombinati 99.83
KOG3873422 consensus Sphingomyelinase family protein [Signal 99.82
TIGR00195254 exoDNase_III exodeoxyribonuclease III. The model b 99.8
COG3568259 ElsH Metal-dependent hydrolase [General function p 99.8
PRK13911250 exodeoxyribonuclease III; Provisional 99.78
TIGR00633255 xth exodeoxyribonuclease III (xth). This family is 99.77
PRK05421263 hypothetical protein; Provisional 99.76
PF03372249 Exo_endo_phos: Endonuclease/Exonuclease/phosphatas 99.7
PTZ00297 1452 pantothenate kinase; Provisional 99.69
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I c 99.66
KOG2756349 consensus Predicted Mg2+-dependent phosphodiestera 99.52
PRK15251271 cytolethal distending toxin subunit CdtB; Provisio 99.41
COG2374798 Predicted extracellular nuclease [General function 99.36
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.22
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.14
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.12
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.11
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.11
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.1
COG3021309 Uncharacterized protein conserved in bacteria [Fun 99.1
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.1
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.01
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.95
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.94
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.93
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.91
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.9
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.87
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.86
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.8
cd0005267 EH Eps15 homology domain; found in proteins implic 98.78
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.73
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.72
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic 98.6
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.58
PTZ00184149 calmodulin; Provisional 98.57
PF1465866 EF-hand_9: EF-hand domain 98.55
PTZ00183158 centrin; Provisional 98.51
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.48
PTZ00184149 calmodulin; Provisional 98.45
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.43
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.43
PTZ00183158 centrin; Provisional 98.43
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.41
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.38
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.37
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.31
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.31
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.31
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.28
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.06
PLN02964 644 phosphatidylserine decarboxylase 98.05
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.04
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.93
KOG0038189 consensus Ca2+-binding kinase interacting protein 97.89
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.85
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.75
PLN02964 644 phosphatidylserine decarboxylase 97.74
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.72
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.67
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.52
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.5
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.34
KOG05661080 consensus Inositol-1,4,5-triphosphate 5-phosphatas 97.29
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.27
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 97.08
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.01
KOG4065144 consensus Uncharacterized conserved protein [Funct 96.94
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 96.79
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 96.77
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.73
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.62
PF14529119 Exo_endo_phos_2: Endonuclease-reverse transcriptas 96.44
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.24
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 96.21
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 95.93
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 95.54
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.25
KOG1294335 consensus Apurinic/apyrimidinic endonuclease and r 95.05
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 94.98
KOG0377631 consensus Protein serine/threonine phosphatase RDG 94.68
PLN03191621 Type I inositol-1,4,5-trisphosphate 5-phosphatase 94.57
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.31
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 93.72
KOG4251362 consensus Calcium binding protein [General functio 93.57
PTZ00312356 inositol-1,4,5-triphosphate 5-phosphatase; Provisi 92.6
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 92.21
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 92.13
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 91.85
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 90.65
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 89.98
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 88.82
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 88.44
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 88.12
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and rel 86.86
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 86.3
COG5411460 Phosphatidylinositol 5-phosphate phosphatase [Sign 84.98
KOG4666412 consensus Predicted phosphate acyltransferase, con 84.89
KOG4578421 consensus Uncharacterized conserved protein, conta 83.81
KOG1976391 consensus Inositol polyphosphate 5-phosphatase, ty 83.58
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 83.01
KOG3866442 consensus DNA-binding protein of the nucleobindin 82.46
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 81.81
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 81.77
>KOG2338 consensus Transcriptional effector CCR4-related protein [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-39  Score=327.80  Aligned_cols=371  Identities=32%  Similarity=0.359  Sum_probs=272.5

Q ss_pred             cEEEEeeccccccccCCcccCccccCCCCcCChHHHHHHHHHHHhhCCCcEEEEeeeccCchhHHHHHHHhhccCCccEE
Q 011119           46 CISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTF  125 (493)
Q Consensus        46 ~lrVmTyNI~~~~y~~~~~~~~~~~~~~~~~~w~~R~~~I~~~I~~~~pDIIcLQEV~~~~~~~~~~l~~~l~~~gY~~~  125 (493)
                      .|+||||||+++.+.+......+ ..+...+.|..|...|+.+|..++|||+|||||+  .+++...+++.+...||..+
T Consensus       116 ~ftvmSYNILAQ~l~~~~~r~~~-~~s~~~L~W~~R~~~Ll~EL~~~dpDIlCLQEVq--~d~~~~~~~~~~~~lGy~~~  192 (495)
T KOG2338|consen  116 DFTVMSYNILAQDLLRDIRRLYF-PESGPALKWLRRSQNLLNELKHYDPDVLCLQEVQ--EDHYPEFWQPLLGKLGYTGF  192 (495)
T ss_pred             ceEEEEehHhHHHHHHHhHHhhc-cCChhhcchhHHhHHHHHHHhhcCCCeeeehhhh--hhhhHHHHHHHHhhcCceEE
Confidence            79999999999988442222212 2567789999999999999999999999999996  45677888999999999999


Q ss_pred             EeecCCCCCceEEEEEecCCceEEeeeeeecCccC------CceeEEEEEeeecccccccCCCCceEEEEEeeecCCCCC
Q 011119          126 SLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFG------DRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDS  199 (493)
Q Consensus       126 ~~~~~~~~~~G~aIl~r~s~f~i~~~~~i~~~~~~------~r~~~~~~~~~~~~~~~~~~~~g~~v~V~ntHL~~~~~~  199 (493)
                      +..+++.+.+||||+|+.++|+++....+.+.+..      ++++.++.++...     ....++.|+|+||||.|+|  
T Consensus       193 ~~r~t~~KthG~ai~w~~~~F~lv~~~~l~y~~~~~~l~n~~NV~lvv~l~f~~-----~~~~sq~ilVanTHLl~np--  265 (495)
T KOG2338|consen  193 FKRRTGTKTHGVAILWHSAKFKLVNHSELNYFDSGSALANRDNVGLVVSLEFRL-----VDESSQGILVANTHLLFNP--  265 (495)
T ss_pred             EEeccCCCCceEEEEEecccceecccchhhcccccchhhcccceeEEEEEEecc-----cCcccCceEEEeeeeeecC--
Confidence            99888889999999999999999999999887654      3455555444321     1113679999999999987  


Q ss_pred             CchHHHHHHHHHHHHHHHHHHhhccCCCCCEEEEecCCCCCCchhhHHHHhCCceecccccCCCCCCCCCcccccccCCC
Q 011119          200 SLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNH  279 (493)
Q Consensus       200 ~~~~~R~~Q~~~l~~~l~~~~~~~~~~~~PvIL~GDFN~~p~s~~~~~L~~~G~~~s~~~~~~~~~~~~~~~~w~s~~~~  279 (493)
                      ..+++|++|.+.|++.++++....+ .+.|+|+|||||+.|.++.|.+|++.++.-..+.++.    ..+...|..+ ++
T Consensus       266 ~~~~vrL~Q~~iiL~~~~~~~~~~~-~~~pi~l~GDfNt~p~~~~y~fl~~~~l~~~~~~~~~----~e~s~~~~~~-~~  339 (495)
T KOG2338|consen  266 SRSDVRLAQVYIILAELEKMSKSSK-SHWPIFLCGDFNTEPDSPPYLFLTSGPLIYDGRAAHT----IEDSHRYVFS-ES  339 (495)
T ss_pred             cccchhhHHHHHHHHHHHHHHhhcc-cCCCeEEecCCCCCCCCCcchhhhcCCceeccccccc----cccccccccc-cc
Confidence            6679999999999999999988654 6889999999999999999999988888765555541    1344445544 22


Q ss_pred             CCCcccccceeccCCCCCCCccchhhHHHHHHHHhhhhhhcccccccccccc-ccCCCCcceeHHHHHHHHHHhhcCCCC
Q 011119          280 RGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFF-KADNNGDVITHSAFCEALRQVNLAGLP  358 (493)
Q Consensus       280 ~~~~~~iD~Ifl~~~~~~~~p~~Ts~~e~~l~~id~il~~~~~~~~~~F~~~-D~d~~~G~I~~~el~~~l~~lg~~g~~  358 (493)
                      +...++.|               ..|..+...+.++.+........++|... |++.. -..++.|+......++..+|.
T Consensus       340 ~~ge~g~d---------------~~~~~~~~s~~k~~~~~~s~~~~e~~t~~g~~~~~-~~~~~~~h~~~~~~~s~~s~g  403 (495)
T KOG2338|consen  340 RLGEEGED---------------DEEESAAFSRGKGQLSQASIPKPEIFTATGDKNHL-VELTYSEHESLKVNVSLYSHG  403 (495)
T ss_pred             ccCccccc---------------chhhhhhhccCccccccccCCCccccccccccchh-HHHHHHHhhhhhcccceeecc
Confidence            22223332               12666666666666655555555666554 33333 356677777733334444444


Q ss_pred             CCCCHHHHHHHHHhhCCCCCcceeHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHhhhhcccchhhhcccCCCCCC
Q 011119          359 YGLSFQETDDLWAQADVDGNGVVNYEEFKVHAYFLSKLLIISFVCQWCLESMLKLLALQQRMWNLSCSAQIENNCNDNME  438 (493)
Q Consensus       359 ~~~~~~e~~~l~~~~D~d~~G~i~~~eF~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  438 (493)
                      |++.  ..+..+.  |.++.|..+|..-.                               ..|....+........++. 
T Consensus       404 ~~~~--~~~~~~~--~~gep~vt~~~~~~-------------------------------~g~~dyif~~~~~~~~~~~-  447 (495)
T KOG2338|consen  404 YGLV--HTENAWL--DRGEPGVTNYALTW-------------------------------KGTLDYIFYSPGDCKQSNR-  447 (495)
T ss_pred             cccc--chhhccc--cCCCcceecHHhhh-------------------------------ccceeeEEeccCcccccch-
Confidence            4444  3444443  88899999998776                               5666555544333333333 


Q ss_pred             CCcccccccccceeecccccCchhhhcCCCCCC-CCCCCCCCeeEEeecc
Q 011119          439 DSKDCSEKEILGFAVKDAFLFPSEVEKGKWPEN-YSLSDHAPLSVVFSPV  487 (493)
Q Consensus       439 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~  487 (493)
                         .-...+.+++.+--++++|.|+.|+-||.| +--|||..|+++|+++
T Consensus       448 ---~~~~~~~ikl~~~l~ip~~~e~~k~~~p~~~~~~SDH~aL~~~~~~~  494 (495)
T KOG2338|consen  448 ---EFEEDEAIKLKGLLRIPSPQEMWKAGQPPNGRYGSDHIALVAQFSLV  494 (495)
T ss_pred             ---hhhcccceeEEEEecCCCHHHhhccCCCCCCCCcccceEeeEeeEee
Confidence               122355788999999999999999999999 8889999999999987

>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>KOG0620 consensus Glucose-repressible alcohol dehydrogenase transcriptional effector CCR4 and related proteins [Transcription] Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3873 consensus Sphingomyelinase family protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>PRK13911 exodeoxyribonuclease III; Provisional Back     alignment and domain information
>TIGR00633 xth exodeoxyribonuclease III (xth) Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>PF03372 Exo_endo_phos: Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family; InterPro: IPR005135 This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling [] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] Back     alignment and domain information
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional Back     alignment and domain information
>COG2374 Predicted extracellular nuclease [General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF14529 Exo_endo_phos_2: Endonuclease-reverse transcriptase ; PDB: 2EI9_A 1WDU_B Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG1294 consensus Apurinic/apyrimidinic endonuclease and related enzymes [Replication, recombination and repair] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information
>KOG1976 consensus Inositol polyphosphate 5-phosphatase, type I [Lipid transport and metabolism] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 6e-04
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 6e-04
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 6e-04
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 7e-04
1up5_B148 Chicken Calmodulin Length = 148 7e-04
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 7e-04
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 7e-04
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 7e-04
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 7e-04
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 7e-04
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 7e-04
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 7e-04
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 7e-04
2ygg_B150 Complex Of Cambr And Cam Length = 150 7e-04
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 7e-04
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 7e-04
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 7e-04
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 7e-04
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 7e-04
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 7e-04
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 8e-04
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 8e-04
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 8e-04
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 8e-04
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 8e-04
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 8e-04
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 9e-04
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 6/61 (9%)
Query: 326 DAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEE 385
           +AF  F  D NG +   SA    LR V +  L   L+ +E D++  +ADVDG+G VNYEE
Sbjct: 87  EAFRVFDKDGNGFI---SA--AELRHV-MTNLGEKLTDEEVDEMIREADVDGDGQVNYEE 140
Query: 386 F 386
           F
Sbjct: 141 F 141
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 2e-23
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 8e-18
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 7e-16
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 5e-13
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 7e-10
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 2e-09
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-09
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 6e-09
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 7e-09
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-08
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 3e-08
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-08
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 3e-08
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 4e-08
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 5e-08
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 6e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-06
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 7e-08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 8e-08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 9e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-07
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-07
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 3e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 7e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 3e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 9e-06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 4e-07
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 5e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 5e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 1e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 6e-07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 7e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 7e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 7e-07
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 7e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 8e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 8e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 6e-06
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-04
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-06
2jnf_A158 Troponin C; stretch activated muscle contraction, 6e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 7e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-06
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 5e-04
3fwb_A161 Cell division control protein 31; gene gating, com 2e-06
3fwb_A161 Cell division control protein 31; gene gating, com 8e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 2e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 3e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 7e-05
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 3e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 5e-04
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 3e-06
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 3e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 3e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 7e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 4e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 6e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 5e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-06
1y1x_A191 Leishmania major homolog of programmed cell death 4e-06
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 5e-06
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 5e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 6e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 7e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 1e-05
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-05
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 2e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 4e-05
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 5e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 5e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 8e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 8e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 8e-05
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 1e-04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 1e-04
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 1e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-04
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 3e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 3e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 4e-04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 4e-04
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 7e-04
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Length = 398 Back     alignment and structure
 Score =  101 bits (252), Expect = 2e-23
 Identities = 43/308 (13%), Positives = 97/308 (31%), Gaps = 47/308 (15%)

Query: 46  CISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVG 105
             +   +N+L   Y            +    +W  R + I++ ++   + +I LQE  V 
Sbjct: 31  SFTVMCYNVLCDKYATRQLYGYCPSWAL---NWEYRKKGIMEEIVNCDADIISLQE--VE 85

Query: 106 NEELVLMYQERLGNAGYNTFSLART---------NNRGDGLLTALHRDYFNVLNYRELLF 156
            E+   ++   L   GY+ F   ++             DG       + F ++    + F
Sbjct: 86  TEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEF 145

Query: 157 NDFGDR----------------------VAQLVHVESVVPFFQNQGGGQQEILIVNTHLL 194
           N                           V ++                +Q +++ N H+ 
Sbjct: 146 NQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMH 205

Query: 195 FPHDSSLSVVRLHQVYKILQYLELYQTENKL---------NHIPIILCGDWNGSKRGHVY 245
           +  D   S V+L Q    +  ++    +            N IP++LC D N      V 
Sbjct: 206 W--DPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV 263

Query: 246 KFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASW 305
           ++L + G   ++    +    +   +   + +N            L++  ++      ++
Sbjct: 264 EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNY 323

Query: 306 AEAVFSII 313
                 +I
Sbjct: 324 TFDFKGVI 331
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Length = 298 Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Length = 267 Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Length = 257 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Length = 317 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Length = 306 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Length = 301 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Length = 266 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 100.0
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 99.95
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 99.94
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 99.94
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.92
4f1h_A250 Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA com 99.92
4gz1_A256 Tyrosyl-DNA phosphodiesterase 2; protein-DNA compl 99.92
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 99.91
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.91
4fva_A256 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.9
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 99.88
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 99.88
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosph 99.85
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 99.85
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70 99.85
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand speci 99.84
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodie 99.83
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, en 99.82
1vyb_A238 ORF2 contains A reverse transcriptase domain; endo 99.82
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA rep 99.81
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP 99.81
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48 99.78
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 99.77
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA 99.75
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four 99.6
1sr4_B261 CDT B, cytolethal distending toxin protein B; bact 99.51
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.co 99.47
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.39
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 99.39
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.27
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 99.24
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.22
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.21
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.21
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.21
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.21
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.19
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.17
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.17
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.17
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.15
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.15
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.14
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.14
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.14
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.13
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.13
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.12
3li6_A66 Calcium-binding protein; calcium signaling protein 99.12
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.12
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.12
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.12
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.11
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.11
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.1
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.09
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.09
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.09
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.08
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.08
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.06
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.06
1c07_A95 Protein (epidermal growth factor receptor pathway 99.04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.03
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.03
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.02
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.02
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.02
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.02
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.01
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.01
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.01
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.01
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.0
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.0
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.0
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.0
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.0
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.0
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.99
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.99
3fwb_A161 Cell division control protein 31; gene gating, com 98.99
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.99
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.99
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.98
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.98
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.98
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.98
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.98
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.97
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.97
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.97
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.97
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.97
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.97
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 98.97
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.97
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.97
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.97
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.96
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.96
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.96
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.95
1y1x_A191 Leishmania major homolog of programmed cell death 98.95
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.94
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.94
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.94
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.94
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.94
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.93
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.93
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.92
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.92
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.92
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.92
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.92
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.92
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.92
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.91
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.91
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.9
3fwb_A161 Cell division control protein 31; gene gating, com 98.9
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.9
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.9
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.88
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.87
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.87
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.87
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.87
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.86
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.86
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.85
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.85
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.85
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.85
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.85
1y1x_A191 Leishmania major homolog of programmed cell death 98.85
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.85
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.85
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.84
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.84
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.84
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.83
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.83
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.83
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.82
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.82
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.82
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.81
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.81
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.81
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.81
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.81
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.8
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.8
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.79
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.78
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.78
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.78
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.78
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.78
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.78
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.77
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.77
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.77
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.76
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.76
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.75
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.75
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.75
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.74
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.73
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.73
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.72
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.72
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.72
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.71
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.71
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.7
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.68
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.68
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.67
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.66
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.65
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.65
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.64
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.64
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.63
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.62
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.61
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.61
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.61
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.61
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.61
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.6
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.6
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.59
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.59
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.58
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.58
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.57
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.57
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.57
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.56
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.55
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.55
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.55
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.54
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.54
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.54
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.53
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.53
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.53
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.53
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.52
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.52
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.52
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.52
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.52
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.5
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.5
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.5
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.49
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 98.49
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.48
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.47
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 98.46
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.46
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.46
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.45
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.45
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.45
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.44
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.43
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.43
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.43
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.43
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.43
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.42
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.41
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.41
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.4
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.4
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.37
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.34
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.33
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.33
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.32
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.32
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.27
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.25
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.24
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.24
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.23
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.22
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.21
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.21
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.19
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.17
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.17
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.13
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.12
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.09
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.0
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.97
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.88
3a4u_B143 Multiple coagulation factor deficiency protein 2; 97.84
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.83
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.8
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.72
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.7
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.55
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.53
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 97.53
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.4
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 97.36
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 97.29
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 97.27
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 97.26
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 97.26
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 97.24
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.05
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.93
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 96.91
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.88
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.83
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.45
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.34
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.19
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.87
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.09
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 94.89
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 94.69
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.3
3li6_A66 Calcium-binding protein; calcium signaling protein 93.74
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 93.61
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 93.44
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 93.24
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 92.57
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 92.42
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 92.39
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 91.93
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 91.84
1c07_A95 Protein (epidermal growth factor receptor pathway 91.82
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 91.79
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 91.71
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 91.69
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 91.52
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 91.49
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 91.46
1qjt_A99 EH1, epidermal growth factor receptor substrate su 91.04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 90.94
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 90.7
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 90.64
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 90.35
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 89.84
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 89.78
2jq6_A139 EH domain-containing protein 1; metal binding prot 89.54
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 89.35
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 89.18
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 88.25
1avs_A90 Troponin C; muscle contraction, calcium-activated, 88.06
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 87.81
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 87.56
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 87.1
2jrf_A184 Tubulin polymerization-promoting protein family me 86.81
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 86.74
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 85.62
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 85.32
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 84.12
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 83.12
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 82.62
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 82.07
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 81.98
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 81.56
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 81.5
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 81.16
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 80.89
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 80.35
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 80.21
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
Probab=100.00  E-value=7.4e-34  Score=292.36  Aligned_cols=291  Identities=16%  Similarity=0.278  Sum_probs=190.3

Q ss_pred             CcccccccccCCCCCCCCCCCCCcEEEEeeccccccccCCcccCccccCCCCcCChHHHHHHHHHHHhhCCCcEEEEeee
Q 011119           23 RVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEF  102 (493)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~lrVmTyNI~~~~y~~~~~~~~~~~~~~~~~~w~~R~~~I~~~I~~~~pDIIcLQEV  102 (493)
                      .+..|..|......   ...+..+||||||||+++.|.+...+ .+|  +.....|..|+..|+++|..++|||||||||
T Consensus        11 ~p~~R~wi~~~~~~---~~~~~~~~~V~syNIl~d~~~~~~~~-~~~--p~~~~~W~~R~~~i~~~i~~~~pDIi~lQEv   84 (398)
T 3ngq_A           11 QLPPRPWITLKERD---QILPSASFTVMCYNVLCDKYATRQLY-GYC--PSWALNWEYRKKGIMEEIVNCDADIISLQEV   84 (398)
T ss_dssp             -CCCCCEEECSCCC-----CCCEEEEEEEEECCCGGGCCTTTC-TTS--CHHHHSHHHHHHHHHHHHHHHCCSEEEEEEE
T ss_pred             CCCCCcceECCCCC---CCCCCCCEEEEEEccCcCcCCccccc-cCC--ChhhcCHHHHHHHHHHHHHhcCCCEEEEecc
Confidence            34455555543221   11223479999999999988876432 344  3456899999999999999999999999999


Q ss_pred             ccCchhHHHHHHHhhccCCccEEEeecCC---------CCCceEEEEEecCCceEEeeeeeecCccC-------------
Q 011119          103 WVGNEELVLMYQERLGNAGYNTFSLARTN---------NRGDGLLTALHRDYFNVLNYRELLFNDFG-------------  160 (493)
Q Consensus       103 ~~~~~~~~~~l~~~l~~~gY~~~~~~~~~---------~~~~G~aIl~r~s~f~i~~~~~i~~~~~~-------------  160 (493)
                      +  ...+.+.+...|...||.+++..+..         .+++|+|||||+++|++++...++|++..             
T Consensus        85 ~--~~q~~~~l~~~L~~~gY~~v~~~k~r~~~~~~~~~~~~eG~AIfyr~~~f~ll~~~~i~ls~~~~~~s~~~~~~~~R  162 (398)
T 3ngq_A           85 E--TEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNR  162 (398)
T ss_dssp             E--HHHHHHTHHHHHHHTTEEEEEEESCTTSCCCHHHHHTCEEEEEEEETTTEEEEEEEEEEHHHHHHHTCTTCHHHHHT
T ss_pred             c--HHHHHHHHHHHHHhCCceEEEecCCCccccccccccCcceeEEEEECCcceEEeeeEEecCCCcccccccchhhhcc
Confidence            5  33445667778888899998875532         35799999999999999999999987521             


Q ss_pred             ----CceeEEEEEeeeccccc-----ccCCCCceEEEEEeeecCCCCCCchHHHHHHHHHHHHHHHHHHhhcc-------
Q 011119          161 ----DRVAQLVHVESVVPFFQ-----NQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENK-------  224 (493)
Q Consensus       161 ----~r~~~~~~~~~~~~~~~-----~~~~~g~~v~V~ntHL~~~~~~~~~~~R~~Q~~~l~~~l~~~~~~~~-------  224 (493)
                          ++++.++.++.......     .+...++.|+|+||||.|+|  ....+|+.|++.|++.++++..+..       
T Consensus       163 i~t~~nval~~~L~~~~~~~~~~~~~~~~~~~~~l~V~nTHL~~~p--~~~~vRl~Q~~~Ll~~l~~~~~~~~~~~~~~~  240 (398)
T 3ngq_A          163 VMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHWDP--EYSDVKLIQTMMFVSEVKNILEKASSRPGSPT  240 (398)
T ss_dssp             TTTCCCEEEEEEEEECGGGC-----------CCEEEEEEEECCCCT--TCHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             eeeccceeEEEEEEEcccccccccccccCCCCcEEEEEEeCcCCCC--CCHHHHHHHHHHHHHHHHHHHHHhhccccccc
Confidence                34555555554321100     01125788999999999976  4679999999999999998764321       


Q ss_pred             --CCCCCEEEEecCCCCCCchhhHHHHhCCceeccccc-C--CCCCCCCCcccccccCCCCCC-ccccccee-ccCCCCC
Q 011119          225 --LNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVA-H--QYTDGDADAHKWVSHRNHRGN-ICGVDFIW-LRNPNQS  297 (493)
Q Consensus       225 --~~~~PvIL~GDFN~~p~s~~~~~L~~~G~~~s~~~~-~--~~~~~~~~~~~w~s~~~~~~~-~~~iD~If-l~~~~~~  297 (493)
                        ....|+|||||||+.|++++|++| +.|.++.-... .  .|..   ....|..... .+. ...+.|-| +.+....
T Consensus       241 ~~~~~~PvIl~GDFNs~P~s~vy~~L-~~G~v~~~h~d~~~~~y~~---~~~~~~~~~~-~~~~~~~~~h~~~L~SAy~~  315 (398)
T 3ngq_A          241 ADPNSIPLVLCADLNSLPDSGVVEYL-SNGGVADNHKDFKELRYNE---CLMNFSCNGK-NGSSEGRITHGFQLKSAYEN  315 (398)
T ss_dssp             ----CCCEEEEEECSCCTTSHHHHHH-HHTEEETTCGGGCC--------GGGGGCC--------CCEEECSCCEEETTTT
T ss_pred             ccCCCCceEEEeeCCCCCCCHHHHHH-hcCCCCCCChhhhhccccc---cccccccccc-ccccccccccCccccccccC
Confidence              136799999999999999999999 56766532110 0  1100   0000100000 000 00122222 1112233


Q ss_pred             CCccchhhHHHHHHHHhhhhhh-ccccccccc
Q 011119          298 RKPLQASWAEAVFSIIKCQLQK-ASLAENDAF  328 (493)
Q Consensus       298 ~~p~~Ts~~e~~l~~id~il~~-~~~~~~~~F  328 (493)
                      .+++||+|+..|.+++||++.+ ..+.+..+.
T Consensus       316 ~~~~fTnyt~~F~g~lDYI~~s~~~l~v~~vl  347 (398)
T 3ngq_A          316 NLMPYTNYTFDFKGVIDYIFYSKTHMNVEGVL  347 (398)
T ss_dssp             TSSSCSEECSSCEECCEEEEEETTTEEEEEEE
T ss_pred             CCCCceeccCCcCCceeEEEEeCCceEEEeec
Confidence            5899999999999999999944 344444433
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4f1h_A Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA complex; HET: DNA; 1.66A {Danio rerio} PDB: 4fpv_A* 4f1h_B* Back     alignment and structure
>4gz1_A Tyrosyl-DNA phosphodiesterase 2; protein-DNA complex, DNA repair, 5'-DNA END processing, endonuclease/exonuclease/phosphatase domain; HET: DNA EPE; 1.50A {Mus musculus} PDB: 4gyz_A* 4gz0_A* 4gz2_A* Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>4fva_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; HET: EDO; 2.07A {Caenorhabditis elegans} Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 3u8u_A 2isi_A Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 493
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-07
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 2e-07
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-07
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-07
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 4e-07
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-07
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 1e-06
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-06
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 3e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 4e-06
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 4e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-06
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 5e-06
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 7e-06
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 2e-05
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-05
d1zwxa1293 d.151.1.3 (A:41-333) Sphingomyelin phosphodiestera 4e-05
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 5e-05
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 7e-05
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 8e-05
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 2e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 4e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 4e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 7e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.001
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 0.001
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.001
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1sr4b_261 d.151.1.1 (B:) Cytolethal distending toxin subunit 0.002
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 0.003
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Caltractin (centrin 2)
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

 Score = 47.2 bits (112), Expect = 1e-07
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 326 DAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEE 385
            AF  F  DN+G  IT        ++     L   L+ +E  ++ A+AD + +  ++ +E
Sbjct: 13  KAFRLFDDDNSG-TITIKDLRRVAKE-----LGENLTEEELQEMIAEADRNDDNEIDEDE 66

Query: 386 F 386
           F
Sbjct: 67  F 67
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Length = 293 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Length = 261 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanov 99.87
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus 99.82
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptas 99.74
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913 99.73
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2 99.62
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus 99.61
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia 99.59
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) 99.52
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.4
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.39
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.39
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.38
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.37
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.36
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.36
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.35
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia col 99.34
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.31
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.31
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.27
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.27
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [ 99.27
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.22
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.19
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.17
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.17
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.16
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.07
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.06
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.05
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.04
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.04
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.02
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.02
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.0
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.0
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.0
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.99
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.99
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.97
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.96
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.96
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.95
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.94
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.94
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.94
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.94
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizos 98.93
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.92
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.89
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.87
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.85
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.85
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.85
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.84
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.83
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.82
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.82
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.81
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.79
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.79
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.78
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.77
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.76
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.76
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.75
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.73
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.71
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.71
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.67
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.65
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.63
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.63
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.62
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.58
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.58
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.57
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.56
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.54
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.53
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.51
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.49
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.46
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.41
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.39
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.38
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.37
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.37
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.34
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.33
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.33
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.31
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.28
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.28
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.21
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.05
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.04
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.01
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.97
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.93
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.88
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.85
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.78
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.72
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.68
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.66
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.66
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.65
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.65
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.45
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.3
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.2
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.96
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.96
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.85
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 96.82
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.27
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 96.19
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.04
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 95.7
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 95.25
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.09
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.05
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.9
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.33
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.32
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.23
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.22
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.16
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.11
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 94.1
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 93.91
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 93.77
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 93.52
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.42
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 93.37
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.0
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 91.29
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 90.97
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 90.82
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 90.27
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 88.93
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 88.4
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 88.07
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 85.5
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 84.79
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 83.57
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 83.56
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 83.39
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 83.28
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 82.81
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 82.78
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 82.71
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 82.3
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 81.61
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 80.15
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Sphingomyelin phosphodiesterase-like
domain: Sphingomyelin phosphodiesterase C
species: Listeria ivanovii [TaxId: 1638]

Probab=99.87  E-value=7.1e-21  Score=183.28  Aligned_cols=224  Identities=14%  Similarity=0.130  Sum_probs=131.0

Q ss_pred             CcEEEEeeccccccccCCcccCccccCCCCcCChHHHHHHHHHHHhhCCCcEEEEeeeccCchhHHHHHHHhhccCCccE
Q 011119           45 CCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNT  124 (493)
Q Consensus        45 ~~lrVmTyNI~~~~y~~~~~~~~~~~~~~~~~~w~~R~~~I~~~I~~~~pDIIcLQEV~~~~~~~~~~l~~~l~~~gY~~  124 (493)
                      +.||||||||+..  .. ..        .....+..|.+.|++.|...+|||||||||+  .....+.+...+.. .|.+
T Consensus         3 ~~lki~s~Nv~~~--~~-~~--------~~~~~~~~r~~~i~~~i~~~~~DVi~LQEv~--~~~~~~~l~~~~~~-~~~~   68 (293)
T d1zwxa1           3 GNFKITSHNVYLF--SR-NI--------YPNWGQMHRADLIAQADYMKNNDVVILNEAF--DTSASHRLLNNLRE-MYPH   68 (293)
T ss_dssp             CSCEEEEEEEEEC--CT-TT--------STTSCHHHHHHHHHTSGGGSSCSEEEEEEEC--SHHHHHHHHHHTTT-TCCE
T ss_pred             CCCEEEEEecCcC--cc-cc--------CCCcCHHHHHHHHHHHHHhcCCCEEEEEccC--CcchHHHHHHHHhh-hccc
Confidence            4799999999752  11 10        1122456789999999999999999999995  33445555555542 3333


Q ss_pred             EEeec----------------CCCCCceEEEEEecCCceEEeeeeeecCccCC--c--eeEEEEEeeecccccccCCCCc
Q 011119          125 FSLAR----------------TNNRGDGLLTALHRDYFNVLNYRELLFNDFGD--R--VAQLVHVESVVPFFQNQGGGQQ  184 (493)
Q Consensus       125 ~~~~~----------------~~~~~~G~aIl~r~s~f~i~~~~~i~~~~~~~--r--~~~~~~~~~~~~~~~~~~~~g~  184 (493)
                      .+...                ......|++|+   +++|+.....+.+.....  .  ....+.+...        ..+.
T Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~il---sr~pi~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~  137 (293)
T d1zwxa1          69 QTPVIGRSKHGWDKTEGNYSNFALEDGGVAVV---SQWPIVEKSQHIFQRGGGADRLSNKGFAYVKIM--------KNGK  137 (293)
T ss_dssp             ECCCTTSCSTTCSEEEC-----CCBCCCCEEE---ESSCEEEEEEEECSCCCGGGGGBCCEEEEEEEE--------ETTE
T ss_pred             eehhcccccccccccccccccccccccceEEE---eccCcccceeeeeeccccccccccceEEEEEEe--------cCCc
Confidence            22111                01124589999   567888776655543321  1  1111111111        1678


Q ss_pred             eEEEEEeeecCCCCCC----chHHHHHHHHHHHHHHHHHHhhccCCCCCEEEEecCCCCCCchhhHHHHhC-Cceecccc
Q 011119          185 EILIVNTHLLFPHDSS----LSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQ-GFVSSYDV  259 (493)
Q Consensus       185 ~v~V~ntHL~~~~~~~----~~~~R~~Q~~~l~~~l~~~~~~~~~~~~PvIL~GDFN~~p~s~~~~~L~~~-G~~~s~~~  259 (493)
                      .++|+|+||.+.....    ....|..|++.++..+.+...   ..+.|+|||||||..|.+..++.+... +.......
T Consensus       138 ~~~v~~~Hl~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~---~~~~~vil~GDfN~~~~~~~~~~~~~~~~~~~~~~~  214 (293)
T d1zwxa1         138 PYHIIGTHTQADDSLISKDTSRAIRAEQMQEIQTFIAKKNI---PKDEIIFIGGDLNVNYGTDEYHDMLKLLNVSSPANF  214 (293)
T ss_dssp             EEEEEEEECCCCCTTSCHHHHHHHHHHHHHHHHHHHHHHTC---CTTSEEEEEEECCCCTTSHHHHHHHHHHTBCCCTTC
T ss_pred             eEEEEEeeeeccCCccchhHHHHHHHHHHHHhhhhhhhhcc---CCCCcEEEEeecCCCCCchHHHHHHhhccccchhhc
Confidence            9999999997643221    123578888888877765432   246799999999999999999877554 33222222


Q ss_pred             cCCCCCCCCCcccccccCCCCCCcccccceeccCCCC
Q 011119          260 AHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQ  296 (493)
Q Consensus       260 ~~~~~~~~~~~~~w~s~~~~~~~~~~iD~Ifl~~~~~  296 (493)
                      .......+.....+.......+...++||||+++...
T Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~iD~I~~s~~~~  251 (293)
T d1zwxa1         215 NGQMATWDPTTNSMLKESYPKAAPEYLDYIFVENGHA  251 (293)
T ss_dssp             CTTSCSBCTTTCHHHHHHCTTSCCBCCEEEEEBTTSC
T ss_pred             ccCCcccccccccccccccCCCCCceEEEEEEecccc
Confidence            1111110111111111111223446799999987643
>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure