Citrus Sinensis ID: 011155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MASLTPPSTAVQPGRIRVLKQGSLDKKRGPVVYWMFRDQRVRDNWALIHAVDQANKNNVPVAVAFNLFDQFLGAKARQLGFMLRGLRLLQRNIEETFQILFFLFQGEAEDNIPNFVRECGASLLVTDFSPLREIRRCKDKICNRVSDSVTIHEVDAHNVVPVWVASEKLEYSAKTLRGKINKLLPEYLIDYPMLEQPIEKWTGTRQSIDWDSIIAAVLRKGAEVPEIGWCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCALEARKARKLCPEAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIYTKEQFEKAQTADPLWNASQMEMVYNGKMHGFMRMYWAKKILEWTTGPEEALAIAIYLNDKYEIDGRDPNGYVGCMWSICGVHDQGWKERPVFGKIRYMNYSGCKRKFDVDGYIAYVKRIVGGTKKRRADSLVSGKEKELCG
ccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHcccccCEEEEcccCEEEccEEccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHcccccccccccccccccccccHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccEEEcccccccccccccccccccccccccHHcccccHHHHHHHHHHHccccccccccccccccccccc
**************************KRGPVVYWMFRDQRVRDNWALIHAVDQANKNNVPVAVAFNLFDQFLGAKARQLGFMLRGLRLLQRNIEETFQILFFLFQGEAEDNIPNFVRECGASLLVTDFSPLREIRRCKDKICNRVSDSVTIHEVDAHNVVPVWVASEKLEYSAKTLRGKINKLLPEYLIDYPMLEQPIEKWTGTRQSIDWDSIIAAVLRKGAEVPEIGWCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCALEARKARKLCPEAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIYTKEQFEKAQTADPLWNASQMEMVYNGKMHGFMRMYWAKKILEWTTGPEEALAIAIYLNDKYEIDGRDPNGYVGCMWSICGVHDQGWKERPVFGKIRYMNYSGCKRKFDVDGYIAYVKRIVGG*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLTPPSTAVQPGRIRVLKQGSLDKKRGPVVYWMFRDQRVRDNWALIHAVDQANKNNVPVAVAFNLFDQFLGAKARQLGFMLRGLRLLQRNIEETFQILFFLFQGEAEDNIPNFVRECGASLLVTDFSPLREIRRCKDKICNRVSDSVTIHEVDAHNVVPVWVASEKLEYSAKTLRGKINKLLPEYLIDYPMLEQPIEKWTGTRQSIDWDSIIAAVLRKGAEVPEIGWCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCALEARKARKLCPEAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIYTKEQFEKAQTADPLWNASQMEMVYNGKMHGFMRMYWAKKILEWTTGPEEALAIAIYLNDKYEIDGRDPNGYVGCMWSICGVHDQGWKERPVFGKIRYMNYSGCKRKFDVDGYIAYVKRIVGGTKKRRADSLVSGKEKELCG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Deoxyribodipyrimidine photo-lyase Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutylpyrimidine dimers (CPDs), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation. Required for plant survival in the presence of UV-B light. Not involved in the repair of (6-4) photoproducts.confidentQ9SB00
Deoxyribodipyrimidine photo-lyase Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutylpyrimidine dimers (CPDs), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation. Required for plant survival in the presence of UV-B light. Not involved in the repair of (6-4) photoproducts.probableQ6F6A2
Deoxyribodipyrimidine photo-lyase Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.probableQ28811

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.1.-.-Carbon-carbon lyases.probable
4.1.99.-Other carbon-carbon lyases.probable
4.1.99.3Deoxyribodipyrimidine photo-lyase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UMV, chain A
Confidence level:very confident
Coverage over the Query: 9-475
View the alignment between query and template
View the model in PyMOL