Citrus Sinensis ID: 011175

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--

MSAPSPGPPAANSSSPPPPVSNPPTISPPPPVSNPPKSSPPPPPVSKPPTTSPPPSPPASNPPTSSSPPASSPPTSSPPPASNPPTSSPPPSPPASSPPTISPPPPVSNPPTRSPPPPSSTPPPNSPPSPPSDPPANSPPPSNPPSNLPPPPPSSVEPPKRSPPSVPPQNPPPPPSSSPPKNSPPAPIAVPPSNVPPPPTQTPPTPASPIAPRPSNSSPNSPPPPSTKRLSPPPGIPVPSTENTPGNGTNPSSPESSSSPSNNGIGTAGTVVIAVAVGIIAFSLIGLVVWCLRRRKKEVSGLNGVYIMPSPLGSSSTTDSSYIKTQSSAPLIGSGPGSDFVNSPQDPGGLGHSRSMFTYEELVKATDGFADQNLLGEGGFGSVYKGYLPDGREVAIKQLKIGGGQGEREFKAEVEIISRIHHRHLVSLVGYCISDDRRLLIYDYVPNNTLYFHLHGEGRPVLDWATRVKIAAGAARGLAYLHEDCKYLIFCF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHcccccccccccccccccEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEEECccCEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEc

*************************************************************************************************************************************************************************************************************************************************************************GTAGTVVIAVAVGIIAFSLIGLVVWCLRRRKKE*******************************************************RSMFTYEELVKATDGFADQNLLGEGGFGSVYKGYLPDGREVAIKQLKIGGGQGEREFKAEVEIISRIHHRHLVSLVGYCISDDRRLLIYDYVPNNTLYFHLHGEGRPVLDWATRVKIAAGAARGLAYLHEDCKYLIFCF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H8H, chain A
Confidence level:very confident
Coverage over the Query: 363-491
View the alignment between query and template
View the model in PyMOL

Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 353-485
View the alignment between query and template
View the model in PyMOL

Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 139-175
View the alignment between query and template
View the model in PyMOL

Template: 3V1V, chain A
Confidence level:probable
Coverage over the Query: 124-135
View the alignment between query and template
View the model in PyMOL

Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 268-299
View the alignment between query and template
View the model in PyMOL

Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 148-223
View the alignment between query and template
View the model in PyMOL