Citrus Sinensis ID: 011187

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-

MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG

cccccHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHcccccHHHHHHccccccccccccccccccccccccEEEEEcccccccccccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHcccccccccccccccc

**SIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQ*******************************************************************TIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPW************************LSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSF******************SFD**FIRESGLLVDSPYVDQTTIE**************************KNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLR*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor GTPase-activating protein AGD1	Probable GTPase-activating protein (By similarity). Regulator of membrane trafficking. Required for maintaining a straight growth of root hairs.	probable	Q9FIT8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q13, chain A
Confidence level:very confident
Coverage over the Query: 7-154,170-217,258-317
View the alignment between query and template
View the model in PyMOL

Template: 2OLM, chain A
Confidence level:very confident
Coverage over the Query: 385-487
View the alignment between query and template
View the model in PyMOL

Template: 2RLO, chain A
Confidence level:very confident
Coverage over the Query: 177-243,256-318
View the alignment between query and template
View the model in PyMOL

Template: 3T9K, chain A
Confidence level:confident
Coverage over the Query: 385-474
View the alignment between query and template
View the model in PyMOL

Template: 2Z0O, chain A
Confidence level:probable
Coverage over the Query: 35-161,177-201,235-311
View the alignment between query and template
View the model in PyMOL