Citrus Sinensis ID: 011187

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG
cccccHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHccccHHHHHHccccccccccccccccccccccccEEEEEcccccccccccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHcccccccccccccccc
cccEEEEEcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEcccccccccEEEEcEEEEEccccccccEEEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccHccccccEEEEcccccEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHcHHHcccccccccccccccccccccHHHHHHHHHHcccccEccccccEcccEEEccccEEEcHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHccccccccccccccc
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRqclngslgspsgdnvkpfprnsNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLdsrgllyyyrkpwswnsaagsqssiqrsnpsetsqGLLSRWLSshyhggvhdeksVARHTVNLLTstikpdadqsdlrfcfriisptkvytlqaentlDQMDWIEKINGVIASLLsfqtpervnvkhclssgpkesfdrcfiresgllvdspyvdqttieehasknitggdhlhsskslgdleyivknekpIDLLRRvygnnkcadcgasepdwaslNLGVLICIQCsgvhrnlgVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIgnnsltderhmg
MASIFFTvafngdgnfvLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNgslgspsgdnvkpFPRNSNKLIEAAMQSAVKGKVQTIKQgylskrssnlradwkrRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTstikpdadqsdLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHasknitggdhlHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRignnsltderhmg
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG
***IFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQ*******************************************************************TIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWN*********************LSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIE*****************SLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIG***********
**SIFFTVAFNGDGNFVLQ************************HNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQ******************************************************************************************FVLDSRGLLYY**************************************************************************************************************************************************************************************PIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVW******************
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNS*******************LLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG
**SIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRE*****************************AA*QS**KGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPW**********S*QRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSF******************SFD**FIRESGLLVDSPYVDQTTIEEHASKNIT******************KNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLR*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query491 2.2.26 [Sep-21-2011]
Q9FIT8 828 ADP-ribosylation factor G yes no 0.916 0.543 0.723 0.0
Q5W7F2 827 ADP-ribosylation factor G no no 0.920 0.546 0.698 1e-179
Q9SMX5 775 ADP-ribosylation factor G no no 0.847 0.536 0.459 1e-112
Q9C6C3 776 ADP-ribosylation factor G no no 0.841 0.532 0.473 1e-108
Q96P50 834 Arf-GAP with coiled-coil, yes no 0.639 0.376 0.294 5e-41
Q5ZK62 781 Arf-GAP with coiled-coil, no no 0.651 0.409 0.277 9e-37
Q6ZQK5 770 Arf-GAP with coiled-coil, no no 0.659 0.420 0.282 7e-35
Q6IVG4 778 Arf-GAP with coiled-coil, yes no 0.653 0.412 0.284 1e-34
Q5FVC7 770 Arf-GAP with coiled-coil, yes no 0.659 0.420 0.282 1e-34
Q15057 778 Arf-GAP with coiled-coil, no no 0.653 0.412 0.281 2e-34
>sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 Back     alignment and function desciption
 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/460 (72%), Positives = 376/460 (81%), Gaps = 10/460 (2%)

Query: 19  QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
           QAREK+LSLRKSTR+DVA  IEEDLH+ART+FEQARF+LV ALSN E+KKRFE LEAV G
Sbjct: 134 QAREKYLSLRKSTRLDVAATIEEDLHSARTTFEQARFHLVSALSNAESKKRFEFLEAVSG 193

Query: 79  TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
           TMDAHLRFFKQGYELLHQMEPFINQVLAYA QSREC++YE ASL++RMQ+Y +Q+DRE+R
Sbjct: 194 TMDAHLRFFKQGYELLHQMEPFINQVLAYAHQSRECANYEMASLNERMQEYQRQVDRETR 253

Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
                S  SP+GD ++   RNS K+IEA MQSA KGKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 N----SCVSPTGDGMRHNSRNSQKVIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRR 309

Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSV 258
           FF+LDSRG+LYYYRKPW+W+S  GS+S + R+  SE S GLLSRWLSSHYHGGVHDEK V
Sbjct: 310 FFILDSRGMLYYYRKPWNWSSGNGSRSVVHRNMASENSPGLLSRWLSSHYHGGVHDEKPV 369

Query: 259 ARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS 318
           ARHTVNLLTSTIK DADQ+DLRFCFRIISPTKVYTLQAEN  DQMDWIEKI GVIASLLS
Sbjct: 370 ARHTVNLLTSTIKVDADQTDLRFCFRIISPTKVYTLQAENAQDQMDWIEKITGVIASLLS 429

Query: 319 FQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKN-ITGGDHLHS 377
           FQTPER  ++     G     D     +SG L D   ++Q    E   ++ +TGG+    
Sbjct: 430 FQTPERAIMRLSTVDGG----DTFSASDSGSLADPYDIEQAESGESTVEHPMTGGNRSRF 485

Query: 378 SKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLG 437
           S  L   + +VK EKPID+L RV GN +CADCGA EPDWASLNLGVLICI+CSG+HRNLG
Sbjct: 486 SGCLQQHD-MVKTEKPIDVLTRVLGNERCADCGAPEPDWASLNLGVLICIECSGIHRNLG 544

Query: 438 VHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELL 477
           VHISKVRSLTLDVKVWEPSVL LFQSLGN+Y NSVWEELL
Sbjct: 545 VHISKVRSLTLDVKVWEPSVLTLFQSLGNVYVNSVWEELL 584
Probable GTPase-activating protein (By similarity). Regulator of membrane trafficking. Required for maintaining a straight growth of root hairs.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 Back     alignment and function description
>sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 Back     alignment and function description
>sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 Back     alignment and function description
>sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=2 SV=1 Back     alignment and function description
>sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query491
255540067 818 gcn4-complementing protein, putative [Ri 0.953 0.572 0.756 0.0
334188557 828 ARF-GAP domain 1 protein [Arabidopsis th 0.916 0.543 0.723 0.0
10176916 768 GCN4-complementing protein homolog [Arab 0.877 0.561 0.713 0.0
297793757 856 ARF-GAP domain 1 [Arabidopsis lyrata sub 0.916 0.525 0.688 0.0
296085519 832 unnamed protein product [Vitis vinifera] 0.928 0.548 0.719 0.0
359491578 822 PREDICTED: ADP-ribosylation factor GTPas 0.912 0.545 0.714 0.0
147791929 822 hypothetical protein VITISV_040393 [Viti 0.912 0.545 0.716 0.0
449469220 1191 PREDICTED: ADP-ribosylation factor GTPas 0.922 0.380 0.713 0.0
449520667 1194 PREDICTED: ADP-ribosylation factor GTPas 0.922 0.379 0.713 0.0
297734503 827 unnamed protein product [Vitis vinifera] 0.920 0.546 0.713 0.0
>gi|255540067|ref|XP_002511098.1| gcn4-complementing protein, putative [Ricinus communis] gi|223550213|gb|EEF51700.1| gcn4-complementing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/473 (75%), Positives = 399/473 (84%), Gaps = 5/473 (1%)

Query: 19  QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
           QAR+KFLSLRKSTRMDVA  +EE+L+NA++SFE ARFNLV ALS VEAKKRFE LEAV G
Sbjct: 134 QARDKFLSLRKSTRMDVAATVEEELYNAKSSFELARFNLVSALSVVEAKKRFEFLEAVSG 193

Query: 79  TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
           TMDAHLR+FKQGYELLHQ+EPFINQVLAYAQQSRECS+YEQASL +R+Q++++QIDRES+
Sbjct: 194 TMDAHLRYFKQGYELLHQLEPFINQVLAYAQQSRECSNYEQASLSERVQEHMRQIDRESK 253

Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
             LNG LGSPSG+ ++ F RNS+K+IEA MQSA KGKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 HSLNGGLGSPSGEGMRIFARNSHKVIEAVMQSASKGKVQTIRQGYLSKRSSNLRGDWKRR 313

Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSV 258
           FFVLDSRG+LYYYRKP+SW S  GSQSS+QR+  ++   GLLSRWLSSHYHGGVHDEK+V
Sbjct: 314 FFVLDSRGMLYYYRKPFSWTSVTGSQSSVQRNVAADNGPGLLSRWLSSHYHGGVHDEKTV 373

Query: 259 ARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS 318
           ARHTVNLLTSTIK DADQSDLRFCFRIISP KVYTLQAEN LDQMDWIEKI GVI SLLS
Sbjct: 374 ARHTVNLLTSTIKVDADQSDLRFCFRIISPVKVYTLQAENALDQMDWIEKITGVITSLLS 433

Query: 319 FQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSS 378
           FQTPER      LS+G + S DR  I E   LVDSP  DQT IE+  S  I    HLHSS
Sbjct: 434 FQTPERR-----LSTGHRGSGDRPTISEGSSLVDSPDNDQTDIEDFTSNIIPPRSHLHSS 488

Query: 379 KSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGV 438
           K     EY +++EKPID+LR V GN+KCADCGA EPDWASLNLGVLICI+CSGVHRNLGV
Sbjct: 489 KLSQQQEYCMRSEKPIDVLRSVPGNDKCADCGAPEPDWASLNLGVLICIECSGVHRNLGV 548

Query: 439 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMG 491
           HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELL+   +   D+   G
Sbjct: 549 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLQSRTSFTADDMAKG 601

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|334188557|ref|NP_201004.2| ARF-GAP domain 1 protein [Arabidopsis thaliana] gi|209572799|sp|Q9FIT8.2|AGD1_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD1; Short=ARF GAP AGD1; AltName: Full=Protein ARF-GAP DOMAIN 1; Short=AtAGD1 gi|332010162|gb|AED97545.1| ARF-GAP domain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10176916|dbj|BAB10160.1| GCN4-complementing protein homolog [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297793757|ref|XP_002864763.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] gi|297310598|gb|EFH41022.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296085519|emb|CBI29251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491578|ref|XP_002280846.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147791929|emb|CAN67895.1| hypothetical protein VITISV_040393 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469220|ref|XP_004152319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520667|ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734503|emb|CBI15750.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query491
TAIR|locus:2183916 827 SFC "SCARFACE" [Arabidopsis th 0.920 0.546 0.704 7.1e-164
TAIR|locus:2197359 775 AGD4 "ARF-GAP domain 4" [Arabi 0.617 0.390 0.469 2.2e-105
TAIR|locus:2025850 776 AGD2 "ARF-GAP domain 2" [Arabi 0.623 0.394 0.473 7.4e-103
DICTYBASE|DDB_G0276395 843 acapB "Arf GTPase activating p 0.193 0.112 0.5 1.7e-37
RGD|1310711 625 Acap3 "ArfGAP with coiled-coil 0.232 0.182 0.463 4.2e-35
UNIPROTKB|D4AAD1 833 Acap3 "Protein Acap3" [Rattus 0.232 0.136 0.463 2.4e-34
UNIPROTKB|F1NGZ5 834 ACAP3 "Uncharacterized protein 0.232 0.136 0.439 3e-34
UNIPROTKB|F1NG96 764 ACAP2 "Arf-GAP with coiled-coi 0.299 0.192 0.382 4.6e-30
UNIPROTKB|Q5ZK62 781 ACAP2 "Arf-GAP with coiled-coi 0.299 0.188 0.382 5.2e-30
UNIPROTKB|F1ME87 745 ACAP1 "Arf-GAP with coiled-coi 0.154 0.102 0.564 9.3e-30
TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1595 (566.5 bits), Expect = 7.1e-164, P = 7.1e-164
 Identities = 325/461 (70%), Positives = 367/461 (79%)

Query:    19 QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
             QAREKFLSLRK T+ DVA  +E++LH +R+ FEQARFNLV ALSNVEAKKRFE LEAV G
Sbjct:   134 QAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVEAKKRFEFLEAVSG 193

Query:    79 TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
             TMDAHLR+FKQGYELLHQMEP+INQVL YAQQSRE S+YEQA+L+++MQ+Y +Q+DRESR
Sbjct:   194 TMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESR 253

Query:   139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
                NGS GSP+GD ++   R+S+K+I+A MQSA +GKVQTI+QGYLSKRSSNLR DWKRR
Sbjct:   254 WGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLSKRSSNLRGDWKRR 313

Query:   199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS--HYHGGVHDEK 256
             FFVLDSRG+LYYYRK  S  S +GSQ S QR N SE   GLLSRWLSS  H HGGVHDEK
Sbjct:   314 FFVLDSRGMLYYYRKQCSKPSGSGSQLSGQR-NSSELGSGLLSRWLSSNNHGHGGVHDEK 372

Query:   257 SVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASL 316
             SVARHTVNLLTSTIK DADQSDLRFCFRIISPTK YTLQAE+ LDQMDWIEKI GVIASL
Sbjct:   373 SVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASL 432

Query:   317 LSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLH 376
             LS Q PE+      + SG   S       ES     S Y D  T EE   +    G +  
Sbjct:   433 LSSQVPEQRLPGSPMGSGHHRSAS-----ESSSYESSEY-DHPTTEEFVCERSFLGYNER 486

Query:   377 SSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNL 436
              S+S      I K EKPID LR+V GN+KCADCGA EPDWASLNLGVL+CI+CSGVHRNL
Sbjct:   487 PSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNL 546

Query:   437 GVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELL 477
             GVHISKVRSLTLDVKVWEPSV++LFQ+LGN +AN+VWEELL
Sbjct:   547 GVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELL 587
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008060 "ARF GTPase activator activity" evidence=IEA;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0030140 "trans-Golgi network transport vesicle" evidence=IDA
GO:0035091 "phosphatidylinositol binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0010051 "xylem and phloem pattern formation" evidence=RCA;IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006897 "endocytosis" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045595 "regulation of cell differentiation" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276395 acapB "Arf GTPase activating protein B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1310711 Acap3 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG96 ACAP2 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZK62 ACAP2 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ME87 ACAP1 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIT8AGD1_ARATHNo assigned EC number0.72390.91640.5434yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.8__2187__AT5G61980.1
annotation not avaliable (856 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query491
pfam01412117 pfam01412, ArfGap, Putative GTPase activating prot 1e-40
smart00105119 smart00105, ArfGap, Putative GTP-ase activating pr 7e-37
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 6e-34
cd07606202 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B 2e-30
COG5347 319 COG5347, COG5347, GTPase-activating protein that r 2e-27
smart00233102 smart00233, PH, Pleckstrin homology domain 2e-12
PLN03114 395 PLN03114, PLN03114, ADP-ribosylation factor GTPase 2e-12
pfam00169101 pfam00169, PH, PH domain 9e-11
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 1e-09
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 2e-09
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 4e-09
cd07307194 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain 3e-08
smart00721239 smart00721, BAR, BAR domain 1e-06
cd07637200 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) 2e-06
cd01233111 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p 3e-06
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 4e-06
cd07603200 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) 5e-06
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 6e-06
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 8e-06
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 1e-05
cd13269106 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) 1e-05
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 2e-05
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 3e-05
cd07638200 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) 6e-05
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 6e-05
cd13251108 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin 1e-04
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 1e-04
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 1e-04
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 1e-04
cd13270118 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing 1e-04
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 1e-04
cd01250114 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat 2e-04
cd07631215 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) 3e-04
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 4e-04
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 7e-04
cd07601215 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) d 7e-04
cd01218123 cd01218, PH_Phafin2-like, Phafin2 (also called EAP 7e-04
PLN03131 705 PLN03131, PLN03131, hypothetical protein; Provisio 0.001
cd07602207 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysi 0.001
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 0.002
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 0.002
cd13302109 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin 0.002
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 0.003
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 0.004
>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf Back     alignment and domain information 
 Score =  141 bits (358), Expect = 1e-40
 Identities = 50/84 (59%), Positives = 60/84 (71%), Gaps = 2/84 (2%)

Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
           ++ +  LR++ GN  CADCGA  P WASLNLG+ ICI+CSGVHR+LGVHISKVRSLTLD 
Sbjct: 1   KRLLRELRKLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLD- 59

Query: 451 KVWEPSVLNLFQSLGNIYANSVWE 474
             W P  L   ++ GN  AN  WE
Sbjct: 60  -KWTPEQLEFMKAGGNKRANEFWE 82

Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117
>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|153271 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>gnl|CDD|214787 smart00721, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|153321 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153287 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153322 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153315 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153285 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|153286 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 491
KOG0521 785 consensus Putative GTPase activating proteins (GAP 100.0
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 100.0
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 100.0
KOG0703 287 consensus Predicted GTPase-activating protein [Sig 99.98
PF01412116 ArfGap: Putative GTPase activating protein for Arf 99.97
smart00105112 ArfGap Putative GTP-ase activating proteins for th 99.96
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 99.96
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 99.93
KOG0706 454 consensus Predicted GTPase-activating protein [Sig 99.93
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 99.93
PLN03131 705 hypothetical protein; Provisional 99.93
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 99.93
KOG0704 386 consensus ADP-ribosylation factor GTPase activator 99.93
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 99.9
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.89
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 99.89
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 99.89
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 99.88
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 99.87
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.87
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 99.87
cd07606202 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain 99.86
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.86
cd07632215 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.86
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.85
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.84
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.8
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.8
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.77
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.76
cd07641215 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.75
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 99.74
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.74
cd07640213 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 99.73
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.73
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.72
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.72
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.71
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.71
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.7
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.69
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.68
cd07642215 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.67
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.67
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.67
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.64
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.63
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.61
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.6
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.58
cd07609214 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domai 99.56
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.54
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.52
PF1540989 PH_8: Pleckstrin homology domain 99.52
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.5
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.46
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.4
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.37
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.34
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.33
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.32
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.3
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.15
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.09
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.08
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.07
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 99.07
KOG0702 524 consensus Predicted GTPase-activating protein [Sig 99.05
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.95
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.86
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.81
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.81
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.8
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 98.75
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.72
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.52
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.47
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.47
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.37
KOG3751622 consensus Growth factor receptor-bound proteins (G 98.19
smart00721239 BAR BAR domain. 98.19
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 98.08
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 98.05
PTZ00267478 NIMA-related protein kinase; Provisional 97.95
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 97.94
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 97.81
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.8
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.73
PTZ00283496 serine/threonine protein kinase; Provisional 97.69
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.68
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.67
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.61
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.55
cd07608192 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) dom 97.48
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.44
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 97.42
KOG3723851 consensus PH domain protein Melted [Signal transdu 97.26
PLN02866 1068 phospholipase D 97.24
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 97.23
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.17
KOG1739 611 consensus Serine/threonine protein kinase GPBP [Si 96.94
KOG35311036 consensus Rho guanine nucleotide exchange factor C 96.89
cd07595244 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) 96.64
KOG35311036 consensus Rho guanine nucleotide exchange factor C 96.55
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 96.46
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 96.29
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.28
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 96.04
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 95.91
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 95.61
PF15406112 PH_6: Pleckstrin homology domain 95.57
cd07618246 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of 95.49
KOG0521785 consensus Putative GTPase activating proteins (GAP 95.18
cd07594229 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom 95.05
cd07592223 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom 94.87
cd07593215 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom 94.87
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.8
cd07591224 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o 94.6
cd07616229 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do 94.55
cd07588211 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma 94.17
PF15408104 PH_7: Pleckstrin homology domain 94.12
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 94.09
cd07611211 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) 94.05
cd00011203 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do 93.96
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 93.82
cd07619248 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of 93.79
cd07620257 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of 93.64
cd07600242 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of 93.63
cd07612211 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B 93.58
cd07613223 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do 93.5
cd07660201 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain 93.36
PF06456229 Arfaptin: Arfaptin-like domain; InterPro: IPR01050 93.2
PF15404185 PH_4: Pleckstrin homology domain 93.01
KOG1737 799 consensus Oxysterol-binding protein [Lipid transpo 92.58
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 92.46
KOG2070661 consensus Guanine nucleotide exchange factor [Nucl 92.33
cd07615223 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do 92.16
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 91.95
cd07614223 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do 91.4
cd07599216 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o 90.75
KOG3771460 consensus Amphiphysin [Intracellular trafficking, 89.34
PF08397219 IMD: IRSp53/MIM homology domain; InterPro: IPR0136 88.93
cd07661204 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of 88.62
cd07659215 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of 88.35
cd07617220 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do 88.32
cd07624200 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o 87.95
KOG3523695 consensus Putative guanine nucleotide exchange fac 86.1
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 86.08
KOG3549505 consensus Syntrophins (type gamma) [Extracellular 86.02
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 84.34
cd07598211 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of 84.27
cd05394313 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the 83.02
cd05135333 RasGAP_RASAL Ras GTPase activating-like protein (R 82.33
cd05128315 RasGAP_GAP1_like The GAP1 family of Ras GTPase-act 81.54
cd07622201 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S 81.5
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 81.48
cd05134310 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of 81.29
cd07628185 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of 81.09
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 80.74
PF10455289 BAR_2: Bin/amphiphysin/Rvs domain for vesicular tr 80.47
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-60  Score=524.51  Aligned_cols=377  Identities=43%  Similarity=0.638  Sum_probs=305.2

Q ss_pred             chhhhhhhHHHHHHHHHHhccCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHH
Q 011187            7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRF   86 (491)
Q Consensus         7 ~~~Fd~~~~~yd~~~~ky~~lsk~k~~~~l~E~~~~L~~~Rk~f~~asldyv~~l~~lq~kk~~e~le~l~~~~~a~~~~   86 (491)
                      ++.||++++.||.+++||.+++|++++.+..|.+++|..+|+.|++.+||||.+|+.+|.+|++++++++++||+++.+|
T Consensus       126 kk~f~ka~~~~d~a~~k~~~l~k~~~~~~~~e~~~~l~~~r~~f~~~~~~y~~~ln~~q~kk~~~~le~~l~~~~aq~~f  205 (785)
T KOG0521|consen  126 KKLFEKASEEYDLALVKYSRLPKKRRSKVKTEVEEELAAARRKFQLTALDYVLALNVLQAKKQFEILETLLGFMHAQINF  205 (785)
T ss_pred             hHHHHHHHhhHHHHHHHhhhhhhccccchhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccchHHHHHHHHHHHhccch
Confidence            78999999999999999999999999888889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCCCCCCCCCCCCCchHHHHH
Q 011187           87 FKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEA  166 (491)
Q Consensus        87 f~~g~e~~~~l~~~~~~l~~~l~~~r~~~~~~~~~l~~~~~~~~~~~~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~~~  166 (491)
                      |++|++++.+++||+.++..++++++.+++.+++.++++++.++.+.+.+.+. .... ..|.+.               
T Consensus       206 F~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~~q~l~~~~~~~~~~-~~~~-~~~~~~---------------  268 (785)
T KOG0521|consen  206 FKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQRYQELRSASNLESRP-KSDS-ASPSGG---------------  268 (785)
T ss_pred             hcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhHHHHHHHHhhhhhhc-cccc-cccccc---------------
Confidence            99999999999999999999999999999999999999999888777665554 1111 112211               


Q ss_pred             HHhhhccCCcceeEEEEEeecCCCcccCceEEEEEEecCceEEEEecCCCCCCcCCCccccccCCCCCcccccccccccc
Q 011187          167 AMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS  246 (491)
Q Consensus       167 ~~~~~~~~~~~~~keGyL~Krs~~~~k~WkrRwFvL~~~g~L~Yyk~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~~~~s  246 (491)
                            +......+.|||+|+.+...+.|.||||.+. ++.+.|........                            
T Consensus       269 ------~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~~~l~~~~r~~~~~----------------------------  313 (785)
T KOG0521|consen  269 ------NLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-DGQLGYQHRGADAE----------------------------  313 (785)
T ss_pred             ------cccchhhhhhhhhhhcccchhhHHhhhhhhh-cccccccccccccc----------------------------
Confidence                  1112345689999998887899999999997 55455544432210                            


Q ss_pred             ccCCCcccccccceeEeecCcceeecCCCCCCCcceEEEEeCCeEEEEEeCCHHHHHHHHHHHHHHHHHHhccCCccccc
Q 011187          247 HYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVN  326 (491)
Q Consensus       247 ~~~~~v~~~~~~~~~~i~l~~~~v~~~~~~~~r~fcF~I~t~~rt~~lqAeSe~e~~~WI~ai~~ai~~~l~~~~~~~~~  326 (491)
                                  .....++.+|.|++.++..+++|||+|++++++|+|||+|+.+..+||.+|+++|..+++...++...
T Consensus       314 ------------~~~~~dL~~csvk~~~~~~drr~CF~iiS~tks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~~~~~~~  381 (785)
T KOG0521|consen  314 ------------NVLIEDLRTCSVKPDAEQRDRRFCFEIISPTKSYLLQAESEKDCQDWISALQNSILSALNSAFLGQDS  381 (785)
T ss_pred             ------------ccccccchhccccCCcccccceeeEEEecCCcceEEecCchhHHHHHHHHHHHHHHHHHhccCccccc
Confidence                        02346688999999887779999999999999999999999999999999999999999998776422


Q ss_pred             ccccCCCCCCCCCccccccccCCccCCCCCCcchhhhhccccccCCCCccCCcccchhhhhccCccHHHHHHcccCCCcc
Q 011187          327 VKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKC  406 (491)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~s~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~N~~C  406 (491)
                      ...+.    .+++.....+.  +..++      .        .++  ..          ...+....+..++..|||..|
T Consensus       382 ~~~~~----~~~~~~~~~s~--~~~~s------~--------~~s--~~----------~~~~~~~~~~~vq~~pgN~~c  429 (785)
T KOG0521|consen  382 TGGRN----TQSGHSSSASY--STITS------A--------NTS--RE----------RLNKGISVIEEVQSVPGNAQC  429 (785)
T ss_pred             ccCCC----ccccccccccc--ccccc------c--------ccc--cc----------ccccCcchhhhhhcCCchhhh
Confidence            21111    11111110000  00000      0        000  00          001112257789999999999


Q ss_pred             cCCCCCCCCceeeccceeEecccccccccCCCCcccceecccCCCCCCHHHHHHHHHhchHHHHHHHhcccCCCC
Q 011187          407 ADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGN  481 (491)
Q Consensus       407 ~dCg~~~p~w~s~n~gv~~C~~CsgiHr~lg~~is~Vks~~ld~~~w~~~~~~~~~~~GN~~~n~~~e~~~~~~~  481 (491)
                      +|||+++|+|+|+|+||.+||+||||||+||||||||+||+||  .|+++.+.+++.+||..+|.|||+++++-.
T Consensus       430 ~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD--~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~  502 (785)
T KOG0521|consen  430 CDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD--VWEPELLLLFKNLGNKYVNEIYEALLPSYD  502 (785)
T ss_pred             hhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh--ccCcHHHHHHHHhCcchhhhhhhccccccc
Confidence            9999999999999999999999999999999999999999999  699999999999999999999999999765

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd07609 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domain of fungal Snf1p-interacting protein 3 Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd07608 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized fungal Arf GAP proteins Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B Back     alignment and domain information
>cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A Back     alignment and domain information
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins Back     alignment and domain information
>cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 Back     alignment and domain information
>cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II Back     alignment and domain information
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 Back     alignment and domain information
>cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 Back     alignment and domain information
>cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 Back     alignment and domain information
>cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 Back     alignment and domain information
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin Back     alignment and domain information
>PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 Back     alignment and domain information
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins Back     alignment and domain information
>KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family Back     alignment and domain information
>cd07661 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of Islet Cell Autoantigen 69-kDa Back     alignment and domain information
>cd07659 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of Protein Interacting with C Kinase 1 Back     alignment and domain information
>cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 Back     alignment and domain information
>cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>KOG3523 consensus Putative guanine nucleotide exchange factor TIM [Signal transduction mechanisms] Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) Back     alignment and domain information
>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL Back     alignment and domain information
>cd05135 RasGAP_RASAL Ras GTPase activating-like protein (RASAL) or RASAL1 is a member of the GAP1 family, and a Ca2+ sensor responding in-phase to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras Back     alignment and domain information
>cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 Back     alignment and domain information
>cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4) Back     alignment and domain information
>cd07628 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>PF10455 BAR_2: Bin/amphiphysin/Rvs domain for vesicular trafficking; InterPro: IPR018859 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query491
3t9k_A 390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-21
3jue_A 368 Crystal Structure Of Arfgap And Ank Repeat Domain O 1e-21
4f1p_A 368 Crystal Structure Of Mutant S554d For Arfgap And An 1e-21
2b0o_E 301 Crystal Structure Of Uplc1 Gap Domain Length = 301 1e-17
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 2e-17
1dcq_A 278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 3e-17
2iqj_A134 Crystal Structure Of The Gap Domain Of Smap1l (Loc6 1e-16
3fm8_C 392 Crystal Structure Of Full Length Centaurin Alpha-1 2e-16
3feh_A 386 Crystal Structure Of Full Length Centaurin Alpha-1 2e-16
2crr_A141 Solution Structure Of Arfgap Domain From Human Smap 3e-16
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 2e-15
2p57_A144 Gap Domain Of Znf289, An Id1-Regulated Zinc Finger 3e-14
2crw_A149 Solution Structure Of The Arfgap Domain Of Adp-Ribo 9e-14
3o47_A 329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 4e-12
3dwd_A147 Crystal Structure Of The Arfgap Domain Of Human Arf 6e-12
2q13_A385 Crystal Structure Of Bar-Ph Domain Of Appl1 Length 2e-09
2owa_A138 Crystal Structure Of Putative Gtpase Activating Pro 5e-09
2z0o_A387 Crystal Structure Of Appl1-Bar-Ph Domain Length = 3 3e-08
2elb_A396 Crystal Structure Of The Bar-Ph Domain Of Human App 6e-07
2olm_A140 Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 7e-05
2z0n_A280 Crystal Structure Of Appl1-Bar Domain Length = 280 2e-04
2q12_A265 Crystal Structure Of Bar Domain Of Appl1 Length = 2 4e-04
2d9l_A134 Solution Structure Of The Arfgap Domain Of Human Ri 6e-04
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 66/110 (60%), Gaps = 8/110 (7%)
Query: 365 ASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVL 424
            S    G   +   +  G + ++V   + +D      GN +C DC    P+WAS+NLGV 
Sbjct: 13  GSAATLGSGGMARGREPGGVGHVVAQVQSVD------GNAQCCDCREPAPEWASINLGVT 66
Query: 425 ICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWE 474
           +CIQCSG+HR+LGVH SKVRSLTLD   WEP ++ L   LGN+  N ++E
Sbjct: 67  LCIQCSGIHRSLGVHFSKVRSLTLD--SWEPELVKLMCELGNVIINQIYE 114
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 Back     alignment and structure
>pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 Back     alignment and structure
>pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 Back     alignment and structure
>pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 Back     alignment and structure
>pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 Back     alignment and structure
>pdb|2Q13|A Chain A, Crystal Structure Of Bar-Ph Domain Of Appl1 Length = 385 Back     alignment and structure
>pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 Back     alignment and structure
>pdb|2Z0O|A Chain A, Crystal Structure Of Appl1-Bar-Ph Domain Length = 387 Back     alignment and structure
>pdb|2ELB|A Chain A, Crystal Structure Of The Bar-Ph Domain Of Human Appl1 Length = 396 Back     alignment and structure
>pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 Back     alignment and structure
>pdb|2Z0N|A Chain A, Crystal Structure Of Appl1-Bar Domain Length = 280 Back     alignment and structure
>pdb|2Q12|A Chain A, Crystal Structure Of Bar Domain Of Appl1 Length = 265 Back     alignment and structure
>pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query491
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 4e-44
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 4e-43
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-42
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 2e-41
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 2e-41
2owa_A138 Arfgap-like finger domain containing protein; zinc 2e-39
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 2e-38
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-38
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 5e-38
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 1e-36
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 1e-36
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 3e-29
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 2e-36
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 2e-36
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 3e-33
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 3e-23
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 3e-22
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 6e-21
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-18
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 4e-18
1wi1_A126 Calcium-dependent activator protein for secretion, 4e-18
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 4e-17
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 7e-17
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 1e-16
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 1e-16
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 2e-16
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 3e-16
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 3e-16
2dkp_A128 Pleckstrin homology domain-containing family A mem 5e-16
3aj4_A112 Pleckstrin homology domain-containing family B ME; 7e-16
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 9e-16
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 1e-15
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 1e-15
2yry_A122 Pleckstrin homology domain-containing family A mem 1e-15
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 1e-15
2d9y_A117 Pleckstrin homology domain-containing protein fami 2e-15
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 9e-15
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-14
3rcp_A103 Pleckstrin homology domain-containing family A ME; 2e-14
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 2e-14
2d9v_A130 Pleckstrin homology domain-containing protein fami 7e-14
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 9e-14
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 1e-13
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 1e-13
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 2e-13
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 2e-13
3cxb_B112 Pleckstrin homology domain-containing family M mem 3e-13
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 5e-13
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 6e-13
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 7e-12
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 2e-11
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 2e-11
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 2e-11
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 6e-11
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 6e-11
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 6e-11
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 7e-11
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 9e-11
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 1e-09
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 5e-09
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 9e-09
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 1e-08
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 2e-08
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 4e-08
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-08
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 9e-08
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 2e-07
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 2e-07
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 3e-06
1v88_A130 Oxysterol binding protein-related protein 8; vesic 5e-06
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 6e-06
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 5e-05
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 5e-05
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-04
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 7e-04
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
 Score =  155 bits (394), Expect = 4e-44
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 2/89 (2%)

Query: 389 KNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTL 448
             ++ I  ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTL
Sbjct: 3   LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTL 62

Query: 449 DVKVWEPSVLNLFQSLGNIYANSVWEELL 477
           D  V   S L L +++GN   N + E  L
Sbjct: 63  D--VLGTSELLLAKNIGNAGFNEIMECCL 89
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Length = 244 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query491
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 100.0
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 100.0
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 100.0
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 100.0
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 99.97
2owa_A138 Arfgap-like finger domain containing protein; zinc 99.97
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 99.97
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 99.97
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 99.96
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 99.96
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 99.95
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.94
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 99.93
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 99.92
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 99.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 99.87
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.85
1wi1_A126 Calcium-dependent activator protein for secretion, 99.83
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.83
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.79
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.79
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.79
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.78
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.78
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.78
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.78
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.78
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.78
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.78
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.77
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.77
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.77
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.77
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.76
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.76
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.76
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.76
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.76
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.76
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.76
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.75
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.75
2yry_A122 Pleckstrin homology domain-containing family A mem 99.75
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.75
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.75
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.75
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.75
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.74
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.74
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.74
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.74
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.73
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.73
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.73
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.73
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.73
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.72
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.72
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.72
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.71
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.71
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.71
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.7
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.67
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.67
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.62
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.62
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.61
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.6
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.6
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.55
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.45
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.42
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.4
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.4
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.37
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.29
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.24
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.22
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.11
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.04
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.03
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.02
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.82
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.81
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 98.66
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.56
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.39
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 98.12
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 98.11
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.09
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.01
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.01
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.96
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.95
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.87
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 97.82
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.8
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.79
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.68
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.64
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.63
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 97.43
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.42
1foe_A377 T-lymphoma invasion and metastasis inducing protei 97.36
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.35
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.3
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 97.15
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.13
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.13
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 96.96
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.94
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.86
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 96.74
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.83
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 95.71
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 95.58
4avm_A237 Bridging integrator 2; protein binding, plasma mem 95.45
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 95.07
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 94.54
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 92.91
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 91.91
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 85.06
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 81.37
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
Probab=100.00  E-value=1.5e-40  Score=345.41  Aligned_cols=248  Identities=27%  Similarity=0.384  Sum_probs=194.9

Q ss_pred             chhhhhhhHHHHHHHHHHhccCCCCCchhH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHH
Q 011187            7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVA-VVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLR   85 (491)
Q Consensus         7 ~~~Fd~~~~~yd~~~~ky~~lsk~k~~~~l-~E~~~~L~~~Rk~f~~asldyv~~l~~lq~kk~~e~le~l~~~~~a~~~   85 (491)
                      +++||+++.+||++++||++++|+|+++.+ .|++++|+++|+.|++++||||.+|+.++.++++++|+.|+.||+++.+
T Consensus       130 kk~fek~~~~yd~al~k~~~~~k~k~~e~~~~ea~~~l~~~rk~f~~~~ldy~~~l~~l~~rk~~e~le~l~~~~~a~~~  209 (385)
T 2q13_A          130 KEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQIS  209 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCCSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            689999999999999999999999988755 5777999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHH-hhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCCCCCCCCCCCCCchHHH
Q 011187           86 FFKQGYELL-HQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLI  164 (491)
Q Consensus        86 ~f~~g~e~~-~~l~~~~~~l~~~l~~~r~~~~~~~~~l~~~~~~~~~~~~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~  164 (491)
                      ||++|++++ ++++||+++|...++++|.+++.+++.+.+.++.++..    ...+     +.|+.+...          
T Consensus       210 ff~~g~~~~~~~~~~~~~~l~~~l~~~r~~~~~~~~~~~~~~~~l~~~----~~~~-----~~~~~~~~~----------  270 (385)
T 2q13_A          210 FFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVA----SDPL-----YVPDPDPTK----------  270 (385)
T ss_dssp             HHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HGGG-----SSSSCCTTT----------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc----CCCC-----CCCCCcccc----------
Confidence            999999998 59999999999999999999999988887776554321    1111     112211000          


Q ss_pred             HHHHhhhccCCcceeEEEEEeecCCC--cccCceEEEEEEecCceEEEEecCCCCCCcCCCccccccCCCCCcccccccc
Q 011187          165 EAAMQSAVKGKVQTIKQGYLSKRSSN--LRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSR  242 (491)
Q Consensus       165 ~~~~~~~~~~~~~~~keGyL~Krs~~--~~k~WkrRwFvL~~~g~L~Yyk~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~  242 (491)
                           . ......++|+|||+|+++.  .++.|+||||||+ ++.|+||++. +.                         
T Consensus       271 -----~-~~~~~~~~k~G~L~K~~~~~~~~~~WkkRwfvL~-~~~L~y~k~~-~~-------------------------  317 (385)
T 2q13_A          271 -----F-PVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQ-GGNLMSQARG-DV-------------------------  317 (385)
T ss_dssp             -----S-CCCCCCSCCEEEEEEC--------CCEEEEEEEE-TTEEEEECSS-CS-------------------------
T ss_pred             -----c-ccCCCCccEEEEEEEecCCCCCcCCceeEEEEEE-CCEEEEecCC-Cc-------------------------
Confidence                 0 0011357899999999765  3457999999998 4568888873 21                         


Q ss_pred             ccccccCCCcccccccceeEeecCcceeecCCCCCCCcceEEEEeCC--eEEEEEeCCHHHHHHHHHHHHHHHHHHhccC
Q 011187          243 WLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPT--KVYTLQAENTLDQMDWIEKINGVIASLLSFQ  320 (491)
Q Consensus       243 ~~~s~~~~~v~~~~~~~~~~i~l~~~~v~~~~~~~~r~fcF~I~t~~--rt~~lqAeSe~e~~~WI~ai~~ai~~~l~~~  320 (491)
                                     .+...|++..|+|.+. +..+++|||+|++++  ++|+|||+|++|+++||.||+.+|..++...
T Consensus       318 ---------------~~~~~i~l~~~~v~~~-~~~~r~~~F~i~t~~~~~~~~l~A~s~~e~~~Wi~ai~~~~~~~~~~~  381 (385)
T 2q13_A          318 ---------------AGGLAMDIDNCSVMAV-DCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSE  381 (385)
T ss_dssp             ---------------SCEEEEECTTCEEEEE-CCTTCSSEEEEECTTSCBCCCEECSSHHHHHHHHHHHHHHHTTCC---
T ss_pred             ---------------CCCceEEccceEEEec-cccCCCceEEEEeCCCCeEEEEEeCCHHHHHHHHHHHHHHHHhhcccc
Confidence                           1234577888888765 346889999999999  9999999999999999999999987666544


Q ss_pred             Cc
Q 011187          321 TP  322 (491)
Q Consensus       321 ~~  322 (491)
                      .|
T Consensus       382 ~~  383 (385)
T 2q13_A          382 NP  383 (385)
T ss_dssp             --
T ss_pred             CC
Confidence            33
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 491
d1dcqa2122 g.45.1.1 (A:247-368) Pyk2-associated protein beta 1e-29
d2elba1268 a.238.1.1 (A:6-273) DCC-interacting protein 13-alp 4e-22
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 2e-19
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 6e-18
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 2e-14
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 1e-13
d1urua_217 a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila 5e-12
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 3e-11
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 5e-11
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 6e-11
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 9e-11
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 1e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 1e-10
d2d4ca1237 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap 2e-10
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 5e-10
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 9e-10
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 2e-09
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 2e-09
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 3e-09
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 4e-09
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 4e-09
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 7e-09
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 2e-08
d1y2oa1248 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain 4e-08
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 7e-08
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 1e-07
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 2e-07
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 5e-07
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 8e-07
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 9e-07
d1i4da_200 a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Hum 5e-06
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 1e-05
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 1e-05
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-05
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 2e-05
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 4e-05
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 6e-05
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 9e-05
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 1e-04
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 2e-04
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 8e-04
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 8e-04
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 0.001
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure

class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  110 bits (275), Expect = 1e-29
 Identities = 42/87 (48%), Positives = 59/87 (67%), Gaps = 2/87 (2%)

Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
           ++ I  ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTLD 
Sbjct: 3   KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD- 61

Query: 451 KVWEPSVLNLFQSLGNIYANSVWEELL 477
            V   S L L +++GN   N + E  L
Sbjct: 62  -VLGTSELLLAKNIGNAGFNEIMECCL 87
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query491
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 99.98
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.82
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.8
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.79
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.76
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.76
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.76
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.75
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.75
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.74
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.74
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.73
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.73
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.72
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.72
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.72
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.72
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.72
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.71
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.7
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.7
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.69
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.69
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.68
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.67
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.65
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.64
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.62
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.6
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.08
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 99.0
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.83
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 98.7
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.6
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.55
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 98.54
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 98.51
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.49
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.33
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.3
d2d4ca1237 Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.96
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.72
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.22
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 96.37
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.21
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 86.93
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 86.91
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.98  E-value=6e-34  Score=245.50  Aligned_cols=94  Identities=45%  Similarity=0.778  Sum_probs=88.8

Q ss_pred             ccHHHHHHcccCCCcccCCCCCCCCceeeccceeEecccccccccCCCCcccceecccCCCCCCHHHHHHHHHhchHHHH
Q 011187          391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYAN  470 (491)
Q Consensus       391 ~~~~~~l~~~~~N~~C~dCg~~~p~w~s~n~gv~~C~~CsgiHr~lg~~is~Vks~~ld~~~w~~~~~~~~~~~GN~~~n  470 (491)
                      ++.++.|++.|+|+.|||||+++|+|||+|||||||++|||+||.||+|||+|||++||  .|++++|++|+.+||..+|
T Consensus         3 ~~~l~~l~~~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld--~w~~~~i~~~~~~GN~~~n   80 (122)
T d1dcqa2           3 KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD--VLGTSELLLAKNIGNAGFN   80 (122)
T ss_dssp             HHHHHHHHHSTTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTS--CCCGGGGHHHHHSCHHHHH
T ss_pred             HHHHHHHHhCCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccC--CCCHHHHHHHHHHhHHHHH
Confidence            46788999999999999999999999999999999999999999999999999999999  7999999999999999999


Q ss_pred             HHHhcccCCCCCCCCc
Q 011187          471 SVWEELLRIGNNSLTD  486 (491)
Q Consensus       471 ~~~e~~~~~~~~~~~~  486 (491)
                      ++||+++|+....+|+
T Consensus        81 ~~~ea~~~~~~~~kp~   96 (122)
T d1dcqa2          81 EIMECCLPSEDPVKPN   96 (122)
T ss_dssp             HHHTTTCCSSSCCSCC
T ss_pred             HHHHhhCCcccCcCCC
Confidence            9999999987655554
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure