Citrus Sinensis ID: 011191

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-

MFKKIMKGRKPSKSDPNDQSLYGFPQRNPIANVVVNHSSRAGPGLPSPNSGSPASVVATPPPMFSIEPLPLFRDVPVSERQNLFLRKLQVCCFQLDFNDTMKSVREKEIKRQTLLELVDFIQSGSAKITENCQEEMIKMISINIFRCLPPASHENTGQEVVDPEEDDPYLEPSWPHLQLVYELLLRYVVSSDTDTKIAKRYIDHSFVLKLLDLFDSEDPREREYLKTILHRIYGKFMVHRPFIRKAINNIFYRFIYETERHSGIGELLEILGSIINGFALPMKEEHKLFLVRALLPLHKPKPVAMYHQQLSYCITQFVEKDYKLADTVIRGLLKYWPLTNCQKEVLFLGELEEVLEATQGAEFQRCMVPLFRQIARCLNSSHFQVAERALFLWNNEHIVSLIAQNRNVILPIIFEALEKNIQSHWNQAVHGLTVNVRKMFLDMDAELFEECQNQYEEKESRAKEVEEQRELTWKRLADVAEQRRGEDMVTV

cHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc

*****************************************************************IEPLPLFRDVPVSERQNLFLRKLQVCCFQLDFNDTMKSVREKEIKRQTLLELVDFIQSGSAKITENCQEEMIKMISINIFRCLPPASH*******VDP**DDPYLEPSWPHLQLVYELLLRYVVSSDTDTKIAKRYIDHSFVLKLLDLFDSEDPREREYLKTILHRIYGKFMVHRPFIRKAINNIFYRFIYETERHSGIGELLEILGSIINGFALPMKEEHKLFLVRALLPLHKPKPVAMYHQQLSYCITQFVEKDYKLADTVIRGLLKYWPLTNCQKEVLFLGELEEVLEATQGAEFQRCMVPLFRQIARCLNSSHFQVAERALFLWNNEHIVSLIAQNRNVILPIIFEALEKNIQSHWNQAVHGLTVNVRKMFLDMDAELFEEC*********************WKRLA**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' alpha isoform	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.	confident	O04375
Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.	probable	O04376
Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.	probable	Q9LU89

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPP, chain B
Confidence level:very confident
Coverage over the Query: 80-455
View the alignment between query and template
View the model in PyMOL