Citrus Sinensis ID: 011273

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49

MSVDGETSRVMKGVQHGACDYLLKPIRMKELRNIWQHVFRKKIHEVRDIENIEGFESIHMTRSGSDQSVDGPLLTGEDLTSVRKRKDAENRHDDRDCGDASSTKKARVVWSIDLHQKFVKAVNQIGFDKVGPKKILDLMNVPWLTRENVASHLQKYRLYLTRLQKDELKTSVGGIKQKDSPSKDSAASFGIQNSITVHHHNDVSNGGYRFSGSNSVVQNVDAKSLEGDVKGIDTIPVTGHKRVLTVDIPNSHKARCSQIGFNGSFVPGHSDVNFTSFDSAIPTQPWSEVSETQFQHEHKPLRLENDFTQLPLPGPRHHIQVDCIQSGPSASSKPSVVDKDNLKPFDCTYKSNYPNAIPIGSAVDTFPVQTTSPIVNHQPFEPIARTTSSMKSQGLNLSCIPDLEAAQRNINWGVGSSLTSLDEDLQLCWLQGDCFAMNLGLQDINFSEYNDPALNSEVPFHLYDTMRFDYEHYYDPTECPIIDQGLFIA

cccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******T***MKGVQHGACDYLLKPIRMKELRNIWQHVFRKKIH*************************************************************ARVVWSIDLHQKFVKAVNQIGFDKVGPKKILDLMNVPWLTRENVASHLQKYRLYLTRLQK******************************TVHHHNDVSNGGYRFSG**SVVQNVDAKSLEGDVKGIDTIPVTGHKRVLTVDI*************************FTSFDSAI***************************************V********************LKPFDCTYKSNYPNA*PIGSAVDTFPVQTTSPIVNH*****************LNLSCIPDLEAAQRNINWGVGSSLTSLDEDLQLCWLQGDCFAMNLGLQDINFSEYNDPALNSEVPFHLYDTMRFDYEHYYDPTECPIIDQGLFIA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Two-component response regulator ARR11	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins.	probable	Q9FXD6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRZ, chain A
Confidence level:very confident
Coverage over the Query: 101-163
View the alignment between query and template
View the model in PyMOL

Template: 3HDG, chain A
Confidence level:confident
Coverage over the Query: 1-44
View the alignment between query and template
View the model in PyMOL