Citrus Sinensis ID: 011308

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49

MRGRHGDVSWMYKRASSKDVDDEYGKEETTIRMPNGLGKDIGNPPWSRSLPHVLVAIISSFLFGYHLGVVNETLESISLDLGFSGSTMAEGLVVSTCLGGAFVGSMFSGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGWWRICFWVATIPAAFLALFMEFCAESPHWLFKRGRGAEAEAELERLFGGLHVKYSMAELSKSERGDEADAVKFSELISPRNFGVVFIGSTLFALQQLSGINAVFYFSSTVFKNAGVPSDSGNICVGIANLSGSIIAMILMDKLGRRVLLLGSFLGMAIAMGVQAIAATSFVSSSGALSLSLGGMLLFVLTFSLGAGPVPSLLLSEIFPNRIRAKAMAVCMAVHWVINFFVGLLFLRLLEQLGPLILYTIFGSFCFLAVIYVKRNVMETKGKTLQEIEMALLPQQ

ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHcccccHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccc

*******************************************PPWSRSLPHVLVAIISSFLFGYHLGVVNETLESISLDLGFSGSTMAEGLVVSTCLGGAFVGSMFSGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGWWRICFWVATIPAAFLALFMEFCAESPHWLFKRGRGAEAEAELERLFGGLHVKYSM**************VKFSELISPRNFGVVFIGSTLFALQQLSGINAVFYFSSTVFKNAGVPSDSGNICVGIANLSGSIIAMILMDKLGRRVLLLGSFLGMAIAMGVQAIAATSFVSSSGALSLSLGGMLLFVLTFSLGAGPVPSLLLSEIFPNRIRAKAMAVCMAVHWVINFFVGLLFLRLLEQLGPLILYTIFGSFCFLAVIYVKRNVMETKGKTLQEIEMAL****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable plastidic glucose transporter 3	May be involved in the efflux of glucose towards the cytosol.	confident	Q2V4B9
Solute carrier family 2, facilitated glucose transporter member 3	Facilitative glucose transporter. Probably a neuronal glucose transporter.	probable	P32037
Solute carrier family 2, facilitated glucose transporter member 3	Facilitative glucose transporter. Probably a neuronal glucose transporter.	probable	P11169

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 47-486
View the alignment between query and template
View the model in PyMOL