Citrus Sinensis ID: 011334


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MMSGNAFTIPSSLGGFVHQEQNPNPNPKPNQAASKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIGSVSNNLFGSSSSNMGNFGHQFQGFHKSMAGATTNSKSANLTLLSELKEETSCLYNSDSTHENKQLKPVAVGPMSATALLQKAAQMGSTRSNNNPITSIFGNGSGFNNVMSSSSSSSNATSYNNNTSLHNTNLSGSAVTLATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQTRGDQQNEQQQQVQLKLTRDFLGMTSGNQVQSVRPFLPQELANFASNIGSVSPIGLSQFTSNN
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccHHccccHHHHHccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccc
cccccccccccccccccccccccccccccccccHHHccccccccccccEEEEEcHHHHHHcccEEEHHccccccHHHHHHHHccccccccEEEEcccccccEEEEEEccccccccccHHHHHHcHHHHHHHHcccccccEEEcccccccEEEEccHHHHHcccccccEEcccccEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHcccccccccccccccc
mmsgnaftipsslggfvhqeqnpnpnpkpnqaaskkkrnlpgtpdpdaevialspktlmATNRFICEICNkgfqrdqnlqlhrrghnlpwklrqRTNKDVIkkkvyicpektcvhhepsralgdltgikkhfsrkhgekkwkcekcskkyavqsdwkahsktcgtreykcdcgtlfsrkdsfiTHRAFCDALAEESTRLASSVVAAASnlnfrtdhtvnlpqgvpqdvagsisqfgsgfaGLAEMVQIGSvsnnlfgssssnmgnfghqfqgfhksmagattnsksANLTLLSELKEetsclynsdsthenkqlkpvavgpMSATALLQKAAQmgstrsnnnpitsifgngsgfnnvmsssssssnatsynnntslhntnlsgsavtlatsdgvmgssnlrsmntTTTAAAVATSDTLNQLMMMQTRGDQQNEQQQQVQLKLTRDflgmtsgnqvqsvrpflpQELANFasnigsvspiglsqftsnn
MMSGNAFTIPSSLGGFVHQEQNPNPNPKPNQAASKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLqlhrrghnlpwklrqrtnkdviKKKVYIcpektcvhhepsralgdltgikkhfsrkhgekkwkcekcskkyavqsdwkahsktcgtreykCDCGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIGSVSNNLFGSSSSNMGNFGHQFQGFHKSMAGATTNSKSANLTLLSELKEETSCLYNSDSTHENKQLKPVAVGPMSATALLQKAAQMGSTRSNNNPITSIFGNGSGFNNVMSSSSSSSNATSYNNNTSLHNTNLSGSAVTLATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQTRGDQQNEQQQQVQLKLTRDFLGMTSGNQVQSVRPFLPQELANFASnigsvspiglsqftsnn
MMSGNAFTIPSSLGGFVHQEqnpnpnpkpnqaaskkkRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGekkwkcekcskkYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLassvvaaasNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIgsvsnnlfgssssnmgnfgHQFQGFHKSMAGATTNSKSANltllselkeetsclYNSDSTHENKQLKPVAVGPMSATALLQKAAQMGSTRSNNNPITSIFgngsgfnnvmsssssssnatsynnntslhntnlsGSAVTLATSDGVMGSSNLRSMNttttaaavatSDTLNQLMMMqtrgdqqneqqqqvqLKLTRDFLGMTSGNQVQSVRPFLPQELANFASNIGSVSPIGLSQFTSNN
*************************************************VIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIGSVSNNL**********************************************************************************************************************************************************************************************FL*************FL***LANF*******************
*MSGNAFTIPS***************PKPNQAASKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQR*********VYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALA****************************************************************************************************************************************KA*****************************************************************************************************************DFLGM***************************************
MMSGNAFTIPSSLGGFVHQE*********************GTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKK*************EKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIGSVSNNLFGSSSSNMGNFGHQFQGFHKSMAGATTNSKSANLTLLSELKEETSCLYNSDSTHENKQLKPVAVGPMSATALL*********RSNNNPITSIFGNGSGFNNV************YNNNTSLHNTNLSGSAVTLATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQT************QLKLTRDFLGMTSGNQVQSVRPFLPQELANFASNIGSVSPIGLSQFTSNN
****************************************PGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTR*************************************************************************************************************************************AQMGS************GN*******************************************************************************************LTRDFLGMTSGNQVQSVRPFLPQELANFASNIG**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSGNAFTIPSSLGGFVHQEQNPNPNPKPNQAASKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDHTVNLPQGVPQDVAGSISQFGSGFAGLAEMVQIGSVSNNLFGSSSSNMGNFGHQFQGFHKSMAGATTNSKSANLTLLSELKEETSCLYNSDSTHENKQLKPVAVGPMSATALLQKAAQMGSTRSNNNPITSIFGNGSGFNNVMSSSSSSSNATSYNNNTSLHNTNLSGSAVTLATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQTRGDQQNEQQQQVQLKLTRDFLGMTSGNQVQSVRPFLPQELANFASNIGSVSPIGLSQFTSNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query488 2.2.26 [Sep-21-2011]
Q700D2503 Zinc finger protein JACKD yes no 0.909 0.882 0.505 1e-119
Q9ZWA6506 Zinc finger protein MAGPI no no 0.362 0.349 0.809 1e-92
Q9FFH3466 Zinc finger protein NUTCR no no 0.422 0.442 0.689 4e-90
Q943I6522 Zinc finger protein STOP1 no no 0.450 0.421 0.298 7e-22
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.297 0.290 0.348 1e-21
Q2QX40465 Zinc finger protein STAR3 no no 0.284 0.298 0.333 2e-19
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.286 0.462 0.342 2e-16
O43313 823 ATM interactor OS=Homo sa yes no 0.311 0.184 0.299 8e-13
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.245 0.146 0.314 1e-11
Q8BXX2756 Zinc finger and BTB domai no no 0.254 0.164 0.270 3e-07
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function desciption
 Score =  429 bits (1102), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 265/524 (50%), Positives = 329/524 (62%), Gaps = 80/524 (15%)

Query: 1   MMSGNAFTIPSSLGGFVHQEQNPN----------------PNPKPNQAASKKKRNLPGTP 44
           M+ G+ F+I SS+GGFVHQE + +                PN KPN +++KKKRN PGTP
Sbjct: 3   MIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTP 62

Query: 45  DPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKK 104
           DPDA+VIALSP TLMATNRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+QR+ ++VIKKK
Sbjct: 63  DPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKK 122

Query: 105 VYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCG 164
           VYICP KTCVHH+ SRALGDLTGIKKH+SRKHGEKKWKCEKCSKKYAVQSDWKAH+KTCG
Sbjct: 123 VYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHAKTCG 182

Query: 165 TREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLAS----SVVAAASNLNFRTDHTV-- 218
           TREYKCDCGTLFSRKDSFITHRAFCDAL EE  R++S    + V + +NLNF  +  V  
Sbjct: 183 TREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSNNNPVISTTNLNFGNESNVMN 242

Query: 219 --NLPQGVPQ------DVAGSISQFGSGFA---------GLAEMVQIGSVSNNLFGSSSS 261
             NLP G         D+  +ISQFG GF          GL+EMVQ+ S  N+    SSS
Sbjct: 243 NPNLPHGFVHRGVHHPDINAAISQFGLGFGHDLSAMHAQGLSEMVQMASTGNHHLFPSSS 302

Query: 262 NMGNFG---HQFQGFHKSMAGATTN----------SKSANLTLLSELKEETSCLYNSDST 308
           +        HQFQ     +   +TN          S+  + +L  +  +++S      S+
Sbjct: 303 SSLPDFSGHHQFQ-----IPMTSTNPSLTLSSSSTSQQTSASLQHQTLKDSSFSPLFSSS 357

Query: 309 HENKQLKPVAVGPMSATALLQKAAQMGSTRSNNNPITSIFGNGSGFNNVMSSSSSSSNAT 368
            ENKQ KP++  PMSATALLQKAAQMGSTRSN++   S F   +     M+SSS++++  
Sbjct: 358 SENKQNKPLS--PMSATALLQKAAQMGSTRSNSSTAPSFFAGPT-----MTSSSATASPP 410

Query: 369 SYNNNTSLHNTNLSGSAVTLATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQTRG 428
             +++  +    L+     +   +       L         + V+TS   N        G
Sbjct: 411 PRSSSPMMIQQQLNNFNTNVLRENHNRAPPPL---------SGVSTSSVDNNPFQSNRSG 461

Query: 429 DQQNEQQQQVQLKLTRDFLGMTSGNQVQSV--RPFLPQELANFA 470
              N  Q   Q+ LTRDFLG+++ +       RPFLPQELA FA
Sbjct: 462 --LNPAQ---QMGLTRDFLGVSNEHHPHQTGRRPFLPQELARFA 500




Probable transcription factor that regulates tissue boundaries and asymmetric cell division by a rapid up-regulation of 'SCARECROW' (SCR), thus controlling the nuclear localization of 'SHORT-ROOT' (SHR) and restricting its action. Required for radial patterning and stem cell maintenance. Counteracted by 'MAGPIE' (MGP).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
359481520490 PREDICTED: zinc finger protein NUTCRACKE 0.924 0.920 0.586 1e-139
255557032525 nucleic acid binding protein, putative [ 0.905 0.841 0.530 1e-136
297741581469 unnamed protein product [Vitis vinifera] 0.901 0.938 0.578 1e-136
147783024474 hypothetical protein VITISV_009698 [Viti 0.840 0.864 0.592 1e-127
357440457500 Zinc finger protein [Medicago truncatula 0.879 0.858 0.497 1e-122
297806263505 zinc finger family protein [Arabidopsis 0.879 0.849 0.493 1e-119
356545973525 PREDICTED: zinc finger protein MAGPIE-li 0.891 0.828 0.513 1e-119
224138662407 predicted protein [Populus trichocarpa] 0.788 0.945 0.523 1e-119
30679912503 zinc finger protein JACKDAW [Arabidopsis 0.909 0.882 0.505 1e-117
110737692497 hypothetical protein [Arabidopsis thalia 0.901 0.885 0.505 1e-116
>gi|359481520|ref|XP_002275477.2| PREDICTED: zinc finger protein NUTCRACKER-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  503 bits (1294), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 309/527 (58%), Positives = 353/527 (66%), Gaps = 76/527 (14%)

Query: 1   MMSGNAFTIPSSLGGFVHQEQNPNPNPKPNQAASKKKRNLPGTPDPDAEVIALSPKTLMA 60
           MMSG+ F+IPSS+  F    Q+P+ NP   +   KKKRNLPGTPDPDAEVIALSPKTLMA
Sbjct: 1   MMSGDMFSIPSSIRTFA---QDPDANPNNLKPPPKKKRNLPGTPDPDAEVIALSPKTLMA 57

Query: 61  TNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSR 120
           TNRFICEICNKGFQRDQNLQLHRRGHNLPWKL+QR+NK+V +KKVYICPEKTCVHH+PSR
Sbjct: 58  TNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQRSNKEV-RKKVYICPEKTCVHHDPSR 116

Query: 121 ALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKD 180
           ALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKD
Sbjct: 117 ALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKD 176

Query: 181 SFITHRAFCDALAEESTRLASSVVAAASNLNFRTD---HTVNLPQ----------GVPQD 227
           SFITHRAFCDALAEE  R+ S    AA+NLNFR D    TV  PQ          G P D
Sbjct: 177 SFITHRAFCDALAEERARITS---VAATNLNFRNDSMNETVINPQPGLLNGFSGRGGP-D 232

Query: 228 VAGSISQFGSGFA----GLAEMVQIGSVSNNLFGSSSSNMGNFGHQFQGFHKSMAGATTN 283
            AG ISQF  GF     GL EMVQ+   ++NLFGSSS  +GNFG   +      + AT+N
Sbjct: 233 AAG-ISQFCPGFGPDLTGLPEMVQV--AASNLFGSSS--VGNFGSCNESPWLDKSSATSN 287

Query: 284 SKSANLTLLS---ELKEE-------TSCLYNSDSTHENKQLKPVAVGPMSATALLQKAAQ 333
              ANL+L S    LKEE          L +  S + ++Q  P A  PMSATALLQKAAQ
Sbjct: 288 --GANLSLASLPHALKEEEGNKGSMVETLTSLYSGNHSQQSSPAA--PMSATALLQKAAQ 343

Query: 334 MGSTRSNNNPITSIFGNGSGFNNVMSSSSSSSNATSYNNNTSLHNTNLSGS-----AVTL 388
           MGSTRSN     S FGN  G  N   S S++ N  ++N N  LH    +G        T 
Sbjct: 344 MGSTRSN----PSFFGNSFGVMNSSGSHSTTLNTLTHNRN-ELHQVFGTGKQHENLMATA 398

Query: 389 ATSDGVMGSSNLRSMNTTTTAAAVATSDTLNQLMMMQTRGDQQNEQQQQVQL-------K 441
           + S+GV+          +  ++  +TS+ L Q MMMQT G Q      ++ L        
Sbjct: 399 SLSEGVLA--------GSGLSSLTSTSNNLAQ-MMMQTSGKQTEPVPLKLHLGSNSVENS 449

Query: 442 LTRDFLGMTSGNQVQSVRPFLPQELANFASNIGSVSPIGLSQFTSNN 488
           LTRDFLGM  G   +S RPFLPQELA FAS +GS   +GLS FTSN+
Sbjct: 450 LTRDFLGMGGG---ESGRPFLPQELAKFAS-MGSA--MGLSHFTSNH 490




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255557032|ref|XP_002519549.1| nucleic acid binding protein, putative [Ricinus communis] gi|223541412|gb|EEF42963.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297741581|emb|CBI32713.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147783024|emb|CAN61309.1| hypothetical protein VITISV_009698 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357440457|ref|XP_003590506.1| Zinc finger protein [Medicago truncatula] gi|355479554|gb|AES60757.1| Zinc finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297806263|ref|XP_002871015.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297316852|gb|EFH47274.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356545973|ref|XP_003541407.1| PREDICTED: zinc finger protein MAGPIE-like [Glycine max] Back     alignment and taxonomy information
>gi|224138662|ref|XP_002322870.1| predicted protein [Populus trichocarpa] gi|222867500|gb|EEF04631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30679912|ref|NP_195935.2| zinc finger protein JACKDAW [Arabidopsis thaliana] gi|75325688|sp|Q700D2.1|JKD_ARATH RecName: Full=Zinc finger protein JACKDAW; AltName: Full=ID1-like zinc finger protein 3 gi|41059985|emb|CAF18563.1| ID1-like zinc finger protein 3 [Arabidopsis thaliana] gi|45935041|gb|AAS79555.1| C2H2 type zinc finger family protein [Arabidopsis thaliana] gi|46367480|emb|CAG25866.1| hypothetical protein [Arabidopsis thaliana] gi|332003178|gb|AED90561.1| zinc finger protein JACKDAW [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110737692|dbj|BAF00785.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
TAIR|locus:2143543503 JKD "AT5G03150" [Arabidopsis t 0.489 0.475 0.602 2.4e-100
TAIR|locus:2205672455 IDD7 "AT1G55110" [Arabidopsis 0.329 0.353 0.807 2.2e-82
TAIR|locus:2078262446 AT3G45260 "AT3G45260" [Arabido 0.329 0.360 0.819 2.8e-80
TAIR|locus:2024193506 MGP "AT1G03840" [Arabidopsis t 0.329 0.318 0.802 2.8e-80
TAIR|locus:2051698602 IDD5 "AT2G02070" [Arabidopsis 0.327 0.265 0.776 1.2e-79
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.366 0.445 0.723 1.9e-79
TAIR|locus:2173624500 IDD1 "AT5G66730" [Arabidopsis 0.327 0.32 0.813 5.9e-78
TAIR|locus:2051688516 IDD4 "indeterminate(ID)-domain 0.327 0.310 0.751 1.9e-77
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.327 0.353 0.807 3.2e-77
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.329 0.345 0.783 4.6e-76
TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 791 (283.5 bits), Expect = 2.4e-100, Sum P(3) = 2.4e-100
 Identities = 162/269 (60%), Positives = 179/269 (66%)

Query:     1 MMSGNAFTIPSSLGGFVHQEXXXXXXXXXX----------------XXXXXXXRNLPGTP 44
             M+ G+ F+I SS+GGFVHQE                                 RN PGTP
Sbjct:     3 MIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTP 62

Query:    45 DPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKK 104
             DPDA+VIALSP TLMATNRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+QR+ ++VIKKK
Sbjct:    63 DPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKK 122

Query:   105 VYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGXXXXXXXXXXXXYAVQSDWKAHSKTCG 164
             VYICP KTCVHH+ SRALGDLTGIKKH+SRKHG            YAVQSDWKAH+KTCG
Sbjct:   123 VYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHAKTCG 182

Query:   165 TREYKCDCGTLFSRKDSFITHRAFCDALAEESTRLXXXXXX----XXXNLNFRTDHTV-- 218
             TREYKCDCGTLFSRKDSFITHRAFCDAL EE  R+             NLNF  +  V  
Sbjct:   183 TREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSNNNPVISTTNLNFGNESNVMN 242

Query:   219 --NLPQGVPQ------DVAGSISQFGSGF 239
               NLP G         D+  +ISQFG GF
Sbjct:   243 NPNLPHGFVHRGVHHPDINAAISQFGLGF 271


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010075 "regulation of meristem growth" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0048364 "root development" evidence=IMP
GO:0051302 "regulation of cell division" evidence=IMP
GO:0045604 "regulation of epidermal cell differentiation" evidence=IMP
GO:0048527 "lateral root development" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q700D2JKD_ARATHNo assigned EC number0.50570.90980.8827yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 488
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.91
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.9
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.75
KOG3576267 consensus Ovo and related transcription factors [T 99.68
KOG3608467 consensus Zn finger proteins [General function pre 99.58
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.56
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.43
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.37
KOG3576267 consensus Ovo and related transcription factors [T 99.35
KOG3608467 consensus Zn finger proteins [General function pre 99.3
PLN03086567 PRLI-interacting factor K; Provisional 99.13
PHA00733128 hypothetical protein 98.95
PLN03086567 PRLI-interacting factor K; Provisional 98.94
PHA00733128 hypothetical protein 98.79
PHA0276855 hypothetical protein; Provisional 98.52
KOG3993500 consensus Transcription factor (contains Zn finger 98.5
PHA0276855 hypothetical protein; Provisional 98.46
KOG3993500 consensus Transcription factor (contains Zn finger 98.35
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.23
PHA0061644 hypothetical protein 97.79
PHA0073279 hypothetical protein 97.71
COG5189423 SFP1 Putative transcriptional repressor regulating 97.67
PHA0061644 hypothetical protein 97.66
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.6
PHA0073279 hypothetical protein 97.41
COG5189423 SFP1 Putative transcriptional repressor regulating 97.26
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.15
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.14
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.12
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.79
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.66
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.64
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.61
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.61
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.57
COG5048467 FOG: Zn-finger [General function prediction only] 96.54
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.39
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.36
smart0035526 ZnF_C2H2 zinc finger. 95.4
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.4
smart0035526 ZnF_C2H2 zinc finger. 95.36
COG5048467 FOG: Zn-finger [General function prediction only] 95.32
KOG1146 1406 consensus Homeobox protein [General function predi 95.31
COG5236493 Uncharacterized conserved protein, contains RING Z 95.19
PRK04860160 hypothetical protein; Provisional 95.11
PRK04860160 hypothetical protein; Provisional 94.69
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.41
KOG1146 1406 consensus Homeobox protein [General function predi 94.38
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.02
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.94
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.9
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.11
COG5236493 Uncharacterized conserved protein, contains RING Z 91.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.75
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 90.71
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 89.67
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 88.62
KOG2893341 consensus Zn finger protein [General function pred 88.14
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 86.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.0
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 84.76
KOG2893341 consensus Zn finger protein [General function pred 83.19
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 81.77
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 81.68
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 81.28
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.91  E-value=2.9e-25  Score=216.16  Aligned_cols=137  Identities=20%  Similarity=0.429  Sum_probs=127.1

Q ss_pred             CCCceecCccccccCChHHHHHHHHhcCCCcccccccccccccCceeecCCCcccCCCCCCccCChhhhhhhhccccCCc
Q 011334           60 ATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEK  139 (488)
Q Consensus        60 ~~kpy~C~~CgK~F~~~~~L~~H~r~H~~p~~~~~~~~~~~~~~kpy~C~~C~C~~~~c~k~F~~~s~L~~H~r~HtgeK  139 (488)
                      ...+|+|.+|||.+.+..+|.+|+.+|..           ...++.+.|++|       +|.|...-.|+.|+|+|+  -
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~-----------~~s~ka~~C~~C-------~K~YvSmpALkMHirTH~--l  186 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRS-----------LDSKKAFSCKYC-------GKVYVSMPALKMHIRTHT--L  186 (279)
T ss_pred             cCCceeccccccccccccccchhhccccc-----------ccccccccCCCC-------CceeeehHHHhhHhhccC--C
Confidence            44579999999999999999999999961           124778999998       999999999999999998  6


Q ss_pred             cccccccCccccchhhhhhhhcc-cCCcceecC-CCCccCChHHHHHHHHHhcCCCccchhhhchhccccCCCcccccC
Q 011334          140 KWKCEKCSKKYAVQSDWKAHSKT-CGTREYKCD-CGTLFSRKDSFITHRAFCDALAEESTRLASSVVAAASNLNFRTDH  216 (488)
Q Consensus       140 py~C~~Cgk~F~~ks~L~~H~rt-~geKpy~C~-CgKsFs~ks~L~~H~r~H~~~~~~~C~~C~~sf~~~s~L~~~~~~  216 (488)
                      +++|.+|||.|.+..-|+-|+|+ +|||||.|. |+|.|..+++|+.||++|...+.|+|..|+|.|+..+.|+-|.+.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            79999999999999999999999 899999999 999999999999999999999999999999999999999977655



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-05
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 7e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
 Score = 57.9 bits (141), Expect = 1e-10
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 27/129 (20%)

Query: 64  FICE--ICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRA 121
           F+C    CNK + +  +LQ+H R H         T +     K Y C  K C      R 
Sbjct: 7   FMCAYPGCNKRYFKLSHLQMHSRKH---------TGE-----KPYQCDFKDC-----ERR 47

Query: 122 LGDLTGIKKHFSRKH-GEKKWKCEKCSKKYAVQSDWKAHSKT-CGTREYKC---DCGTLF 176
                 +K+H  R+H G K ++C+ C +K++     K H++T  G + + C    C   F
Sbjct: 48  FSRSDQLKRH-QRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKF 106

Query: 177 SRKDSFITH 185
           +R D  + H
Sbjct: 107 ARSDELVRH 115


>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.9
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.83
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.78
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.74
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.68
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.65
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.64
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.64
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.56
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.56
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.55
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.5
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.48
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.44
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.41
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.38
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.37
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.36
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.34
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.34
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.33
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.29
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.28
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.28
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.24
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.23
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.21
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.17
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.15
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.12
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.1
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.0
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.98
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.94
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.94
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.94
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.9
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.88
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.87
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.85
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.83
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.83
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.82
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.82
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.82
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.81
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.8
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.8
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.8
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.8
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.8
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.78
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.78
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.78
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.76
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.76
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.73
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.72
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.71
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.69
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.69
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.67
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.67
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.66
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.65
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.65
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.65
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.65
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.62
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.61
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.6
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.6
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.59
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.59
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.59
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.59
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.58
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.57
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.56
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.56
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.56
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.54
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.54
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.53
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.53
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.5
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.5
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.42
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.33
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.31
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.26
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.25
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.18
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.16
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.15
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.1
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.04
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.03
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.95
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.92
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.92
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.92
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.88
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.88
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.86
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.86
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.85
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.85
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.84
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.83
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.83
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.83
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.81
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.81
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.8
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.8
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.79
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.79
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.79
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.78
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.77
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.74
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.74
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.71
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.9
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.68
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.86
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.64
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.64
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.6
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.6
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.76
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.56
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.52
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.65
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.47
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.41
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.39
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.5
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.34
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.34
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.25
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.22
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.17
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.24
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.1
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.02
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.8
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.49
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.47
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.06
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.71
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.87
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.01
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.94  E-value=3.5e-28  Score=226.33  Aligned_cols=164  Identities=24%  Similarity=0.471  Sum_probs=143.6

Q ss_pred             cCCCCCCCCCCCCchhHhhcCccccCCCCceecCccccccCChHHHHHHHHhcCCCcccccccccccccCceeecCCCcc
Q 011334           34 SKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTC  113 (488)
Q Consensus        34 ~k~k~~~p~~~~~~~~~l~~~~k~~~~~kpy~C~~CgK~F~~~~~L~~H~r~H~~p~~~~~~~~~~~~~~kpy~C~~C~C  113 (488)
                      .+..+..|+..+.....+..|.+.|.++++|.|++|++.|.....|..|++.|.              ++++|.|++|  
T Consensus        20 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------------~~~~~~C~~C--   83 (190)
T 2i13_A           20 KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHT--------------GEKPYKCPEC--   83 (190)
T ss_dssp             -----------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHH--------------CCCCEECTTT--
T ss_pred             CCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcC--------------CCCCccCccc--
Confidence            457889999999999999999999999999999999999999999999999996              7889999998  


Q ss_pred             cCCCCCCccCChhhhhhhhccccCCccccccccCccccchhhhhhhhcc-cCCcceecC-CCCccCChHHHHHHHHHhcC
Q 011334          114 VHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKT-CGTREYKCD-CGTLFSRKDSFITHRAFCDA  191 (488)
Q Consensus       114 ~~~~c~k~F~~~s~L~~H~r~HtgeKpy~C~~Cgk~F~~ks~L~~H~rt-~geKpy~C~-CgKsFs~ks~L~~H~r~H~~  191 (488)
                           ++.|.....|..|+++|+++++|.|++|++.|.....|..|+++ +++++|.|+ |++.|.++..|..|+++|++
T Consensus        84 -----~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~  158 (190)
T 2i13_A           84 -----GKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTG  158 (190)
T ss_dssp             -----CCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHC
T ss_pred             -----CCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCC
Confidence                 99999999999999999999999999999999999999999999 799999999 99999999999999999999


Q ss_pred             CCccchhhhchhccccCCCcccccCCC
Q 011334          192 LAEESTRLASSVVAAASNLNFRTDHTV  218 (488)
Q Consensus       192 ~~~~~C~~C~~sf~~~s~L~~~~~~~~  218 (488)
                      +++|.|.+|++.|.....|..|...+.
T Consensus       159 ~~~~~C~~C~~~f~~~~~L~~H~~~H~  185 (190)
T 2i13_A          159 EKPYKCPECGKSFSRRDALNVHQRTHT  185 (190)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHTTC-
T ss_pred             CCCeECCCCCCccCCHHHHHHHHHhcC
Confidence            999999999999999999998776543



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 488
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.4 bits (86), Expect = 1e-04
 Identities = 14/51 (27%), Positives = 20/51 (39%), Gaps = 3/51 (5%)

Query: 138 EKKWKCEKCSKKYAVQSDWKAHSKTCGT-REYKCD-CGTLFSRKDSFITHR 186
           +K + C+ C K +  +S    H       R Y C  CG  F  K   + H 
Sbjct: 1   DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHM 50


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.43
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.35
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.88
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.86
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.8
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.78
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.69
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.68
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.65
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.64
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.62
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.62
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.58
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.55
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.49
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.49
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.46
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.46
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.45
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.43
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.38
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.37
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.3
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.26
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.25
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.23
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.22
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.07
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.07
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.95
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.95
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.95
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.94
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.75
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.74
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.61
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.43
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.12
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.96
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.86
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.78
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.73
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.68
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.59
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.55
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.44
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.39
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.34
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.24
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.1
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.02
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.99
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.91
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.89
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.82
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.65
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.63
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.42
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.23
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.17
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.14
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.09
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.03
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.99
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.93
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.79
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.76
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.68
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.58
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.46
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.14
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.1
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.77
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.03
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.88
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.72
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.15
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.93
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 90.92
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.64
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 90.5
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.06
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.2
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.18
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.99
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.98
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.26
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.71
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 85.37
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.02
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.84
d1y0jb136 U-shaped transcription factor, different fingers { 82.71
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 81.94
d1y0jb136 U-shaped transcription factor, different fingers { 81.61
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.43  E-value=2.3e-14  Score=105.79  Aligned_cols=51  Identities=29%  Similarity=0.688  Sum_probs=33.5

Q ss_pred             CccccccccCccccchhhhhhhhcc-cCCcceecC-CCCccCChHHHHHHHHHh
Q 011334          138 EKKWKCEKCSKKYAVQSDWKAHSKT-CGTREYKCD-CGTLFSRKDSFITHRAFC  189 (488)
Q Consensus       138 eKpy~C~~Cgk~F~~ks~L~~H~rt-~geKpy~C~-CgKsFs~ks~L~~H~r~H  189 (488)
                      ||||+|+ ||+.|..+..|..|+++ +++|||.|. ||+.|...+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4666663 66666666666666666 566666666 666666666666666655



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure