Citrus Sinensis ID: 011367


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MLLSLFLRQATKDAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHGKDISKDKRAIGKLRREAERAKRALSSQHQVRVEIESLFDGIDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKNQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITAVYQRSGGAPGAGTESSDDDDSHDEL
ccccccHHHHHHHHcHHcccEEEEEccHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEEccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccCEEECccccccccccccccccccccccccccccccEEEEccccccccEEEEEEEcccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
MLLSLFLRQATKDAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHGKDISKDKRAIGKLRREAERAKRALSSQHQVRVEIESLFDGIDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKNQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKAEDK**GKS**ITITNDKGRLSQEEIDRMVREAEEFAE**K******DARNSLETYVYNMKN*******************IETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITAVYQ**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLSLFLRQATKDAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHGKDxxxxxxxxxxxxxxxxxxxxxLSSQHQVRVEIESLFDGIDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKNQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEExxxxxxxxxxxxxxxxxxxxxIDARNSLETYVYNxxxxxxxxxxxxxxxxxxxxxKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCNPIITAVYQRSGGAPGAGTESSDDDDSHDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 37a In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentQ9LKR3
Mediator of RNA polymerase II transcription subunit 37f In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentQ39043
Luminal-binding protein 3 Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.probableO24581

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 1-405
View the alignment between query and template
View the model in PyMOL
Template: 2KHO, chain A
Confidence level:very confident
Coverage over the Query: 1-464
View the alignment between query and template
View the model in PyMOL