Citrus Sinensis ID: 011368


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MILNREEASASLEWKCSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTPNQHISRSELEKQMDFTSTSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYSNLLRIFSHGVGSAGGITVEAGKNENRKPILQAAPRARRSSLSNLTRGLYRQAHENSSSGHHELSYNLSSKLLHLAWHPTTNLIACANGNSLFFHYA
cccccccccccccEEEEEEcccccccccccccccEEEEEEcccccEEEECccccEEEEEEEcccccccccccccccEEEEcccccccccccEEEEEECcccccccccccEEEEccEEEEEEECcccccEEEEECccccEEEEEEEcccEEEEEcccccccccccccCCccccccccccccccccccCEEEEEccCEEEccccccccEEEEEEcccccEEEECccccEEEEEcccccCEEEEEcccccccccccccEEEEEECcccccEEEEEccccEEEEEEccccccccccccEEEccccccccccccccccccEEEEEEcccccEEEECcccEEEEEEcccccccEEEEEEccccccccccccccccccccEEEEECccccEEEEECcccEEEEEEccccccccEEEEcccccccccCECcccccccccccccccccccccccccccccccccccccccEEEEECcccccEEEEEEcccEEEEEc
***************CSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTPNQHISRSELEKQMDFTSTSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYSNLLRIFSHGVGSAGGITVEAGKN**************************************ELSYNLSSKLLHLAWHPTTNLIACANGNSLFFHYA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILNREEASASLEWKCSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTPNQHISRSELEKQMDFTSTSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYSNLLRIFSHGVGSAGGITVEAGKNENRKPILQAAPRARRSSLSNLTRGLYRQAHENSSSGHHELSYNLSSKLLHLAWHPTTNLIACANGNSLFFHYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.probableQ0E2P1
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.probableQ39247
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.probableQ66LE6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DW8, chain B
Confidence level:very confident
Coverage over the Query: 10-63,85-487
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:confident
Coverage over the Query: 28-66,92-101,114-487
View the alignment between query and template
View the model in PyMOL