Citrus Sinensis ID: 011392


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MLPQKQAEEAIVSNFSETEHEGGGKEEGREDEQQQQHSMLSMKSFLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQMGMLSGILLQIFYGFLGSWTAYLISVLYVEYRSRKEKENVSFKNHVIQWFEVLDGLLGPYWKAVGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIAAVVHGQVEGASHTAPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLFATLYVFTLTIPSATAVYWSFGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFLPSWTAMYAFNIFVVVWVFVVGFGFGGWASVTNFVRQVDSFGLFAKCYQCKPPPPPAGAAAAGAHH
cccccccHHHHccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
******************************************KSFLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQMGMLSGILLQIFYGFLGSWTAYLISVLYVEYRSRKEKENVSFKNHVIQWFEVLDGLLGPYWKAVGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIAAVVHGQVEGASHTAPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLFATLYVFTLTIPSATAVYWSFGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFLPSWTAMYAFNIFVVVWVFVVGFGFGGWASVTNFVRQVDSFGLFAKCYQC****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPQKQAEEAIVSNFSETEHEGGGKEEGREDEQQQQHSMLSMKSFLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQMGMLSGILLQIFYGFLGSWTAYLISVLYVEYRSRKEKENVSFKNHVIQWFEVLDGLLGPYWKAVGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIAAVVHGQVEGASHTAPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLFATLYVFTLTIPSATAVYWSFGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFLPSWTAMYAFNIFVVVWVFVVGFGFGGWASVTNFVRQVDSFGLFAKCYQCKPPPPPAGAAAAGAHH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin transporter-like protein 1 Carrier protein involved in proton-driven auxin influx. May mediate the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips.confidentQ5N892
Auxin transporter protein 1 Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex. Unloads auxin from the mature phloem to deliver the hormone to the root meristem via the protophloem cell files. Coordinated subcellular localization of AUX1 is regulated by a brefeldin A-sensitive (BFA) vesicle trafficking process. Involved in lateral root formation, trichoblast polarization and root hair elongation. Required for gravitropism and thigmotropism, especially in roots, by modulating responses to auxin, ethylene and cytokinins such as benzyladenine (BA). Needed for ammonium-mediated root-growth inhibition. Confers sensitivity to the herbicide 2,4-dichlorophenoxyacetic acid (2,4-D, auxin analog), and to polar auxin transport inhibitors such as N-1-naphthylphthalamic acid (NPA) and 2,3,5-triiodobenzoic acid (TIBA).confidentQ96247
Auxin transporter-like protein 2 Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex (By similarity). May be involved in lateral roots and nodules formation.probableQ9FEL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 48-298
View the alignment between query and template
View the model in PyMOL