Citrus Sinensis ID: 011400

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MAPCAQVHNLDFDIRALTKCLKEGIITSRFIISKFIIGPPHAFFYSFGSPPFQFSLAIQLAGCCSVETERERFFFFLIFILSAISLLLRLSNLSAMADEPMPTRWTFQFGRKKIKEPEKGEITERPVSDGSSLNSNGHVQNTSDMAVYEQYRTQGSGSTCLNGVLANVINERLQKPLLPNFDSAETRALAESLCRDIIRGSPDVKWESIKGLENAKRLLKEAVVMPIKYPKYFTGLLSPWKGILLFGPPGTGKTMLAKAVATECKTTFFNISASSVVSKWRGDSEKLIKVLFELARHHAPSTIFLDEIDAIISQRGEARSEHEASRRLKTELLIQMDGLTQSDELVFVLAATNLPWELDAAMLRRLEKRILVPLPDTEARRAMFESLLPSQTGEESLPYDLLVERTEGYSGSDIRLVSKEAAMQPLRRLMVLLEGRQEVAPDDELPQIGPIRPEDVEIALKNTRPSAHLHAHRYEKFNADYGSEILQ
cccccccccccccHHHHHHHHHHccEEEEEEEEccEEccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccc
****AQVHNLDFDIRALTKCLKEGIITSRFIISKFIIGPPHAFFYSFGSPPFQFSLAIQLAGCCSVETERERFFFFLIFILSAISLLLRLSNLSAMAD**MPTRWTFQF************************************************************NERLQKPLLPNFDSAETRALAESLCRDIIRGSPDVKWESIKGLENAKRLLKEAVVMPIKYPKYFTGLLSPWKGILLFGPPGTGKTMLAKAVATECKTTFFNISASSVVSKWRGDSEKLIKVLFELARHHAPSTIFLDEIDAIIS***************KTELLIQMDGLTQSDELVFVLAATNLPWELDAAMLRRLEKRILVPLPDTEARRAMFESLLPSQTGEESLPYDLLVERTEGYSGSDIRLVSKEAAMQPLRRLMVLL****************PIRPEDVEIALKNTRPSAHLHAHRYEKFNADYGS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPCAQVHNLDFDIRALTKCLKEGIITSRFIISKFIIGPPHAFFYSFGSPPFQFSLAIQLAGCCSVETERERFFFFLIFILSAISLLLRLSNLSAMADEPMPTRWTFQFGRKKIKEPEKGEITERPVSDGSSLNSNGHVQNTSDMAVYEQYRTQGSGSTCLNGVLANVINERLQKPLLPNFDSAETRALAESLCRDIIRGSPDVKWESIKGLENAKRLLKEAVVMPIKYPKYFTGLLSPWKGILLFGPPGTGKTMLAKAVATECKTTFFNISASSVVSKWRGDSEKLIKVLFELARHHAPSTIFLDEIDAIISQRGEARSEHEASRRLKTELLIQMDGLTQSDELVFVLAATNLPWELDAAMLRRLEKRILVPLPDTEARRAMFESLLPSQTGEESLPYDLLVERTEGYSGSDIRLVSKEAAMQPLRRLMVLLEGRQEVAPDDELPQIGPIRPEDVEIALKNTRPSAHLHAHRYEKFNADYGSEILQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.3Microtubule-severing ATPase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QP9, chain X
Confidence level:very confident
Coverage over the Query: 203-482
View the alignment between query and template
View the model in PyMOL
Template: 3M6A, chain A
Confidence level:confident
Coverage over the Query: 159-186,198-275,287-312,331-465
View the alignment between query and template
View the model in PyMOL
Template: 2DL1, chain A
Confidence level:probable
Coverage over the Query: 14-90
View the alignment between query and template
View the model in PyMOL