Citrus Sinensis ID: 011451
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 485 | ||||||
| 350536163 | 485 | serine/threonine-protein phosphatase 5 [ | 0.997 | 0.997 | 0.896 | 0.0 | |
| 343488864 | 485 | serine/threonine protein phosphatase 5 [ | 0.997 | 0.997 | 0.898 | 0.0 | |
| 355329952 | 485 | serine/threonine-protein phosphatase 5 [ | 0.997 | 0.997 | 0.892 | 0.0 | |
| 224128732 | 488 | predicted protein [Populus trichocarpa] | 0.997 | 0.991 | 0.891 | 0.0 | |
| 255558752 | 476 | protein phosphatase-5, putative [Ricinus | 0.973 | 0.991 | 0.896 | 0.0 | |
| 18406066 | 484 | serine/threonine-protein phosphatase 5 [ | 0.993 | 0.995 | 0.871 | 0.0 | |
| 449444753 | 485 | PREDICTED: serine/threonine-protein phos | 1.0 | 1.0 | 0.861 | 0.0 | |
| 357127077 | 483 | PREDICTED: serine/threonine-protein phos | 0.991 | 0.995 | 0.825 | 0.0 | |
| 326523823 | 483 | predicted protein [Hordeum vulgare subsp | 0.991 | 0.995 | 0.819 | 0.0 | |
| 79324899 | 538 | serine/threonine-protein phosphatase 5 [ | 0.993 | 0.895 | 0.773 | 0.0 |
| >gi|350536163|ref|NP_001234232.1| serine/threonine-protein phosphatase 5 [Solanum lycopersicum] gi|24954813|gb|AAN64317.1| type 5 serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] gi|28141084|gb|AAO26214.1| type 5 protein serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
Score = 921 bits (2380), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 434/484 (89%), Positives = 464/484 (95%)
Query: 1 MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTK 60
MP ME ENS+ SRAEELK LANEAF+ KYSQAIDLY+QAIELN +NAVYYANRAFAHTK
Sbjct: 1 MPGMEAENSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTK 60
Query: 61 LEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQ 120
LEEYGSAIQD ++AIEIDPRY KGYYRRGAAYLAMGKFK+ALKDFQQVKKL PNDPDA +
Sbjct: 61 LEEYGSAIQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDATK 120
Query: 121 KVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKK 180
K+KECEKAV KLKFEEAI+VPES+R SVADSIDY+S+EVEPQY+GARIEGDV+TLDFVKK
Sbjct: 121 KLKECEKAVMKLKFEEAISVPESQRRSVADSIDYRSVEVEPQYAGARIEGDVVTLDFVKK 180
Query: 181 MMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNI 240
M+DDFKNQK LHKRYA+QIVLQTREMLRALPSLVDI +P+GKHFTVCGDVHGQFYDLLNI
Sbjct: 181 MLDDFKNQKNLHKRYAYQIVLQTREMLRALPSLVDIVVPEGKHFTVCGDVHGQFYDLLNI 240
Query: 241 FELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIY 300
FELNGLPSE+NPYLFNGDFVDRGSFS+EVILTLFAFKCMCPSAI+L+RGNHESKSMNKIY
Sbjct: 241 FELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMCPSAIHLARGNHESKSMNKIY 300
Query: 301 GFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFC 360
GFEGEVRSKLSE FVELFAEVFCCLPLAHV+N+KVFVVHGGLFSVDGVKLSDI+ IDRFC
Sbjct: 301 GFEGEVRSKLSEIFVELFAEVFCCLPLAHVINEKVFVVHGGLFSVDGVKLSDIRAIDRFC 360
Query: 361 EPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLDLVVRSHEVKDEG 420
EPPEEGLMCELLWSDPQP PGRGPSKRGVGLSFG DVTKRFLQ+N+LDLVVRSHEVKDEG
Sbjct: 361 EPPEEGLMCELLWSDPQPQPGRGPSKRGVGLSFGGDVTKRFLQENNLDLVVRSHEVKDEG 420
Query: 421 YEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNF 480
YEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAP +KPNIVTF+AVPHPDVKPMAYANNF
Sbjct: 421 YEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNF 480
Query: 481 LRMF 484
LRMF
Sbjct: 481 LRMF 484
|
Source: Solanum lycopersicum Species: Solanum lycopersicum Genus: Solanum Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|343488864|gb|AEM45799.1| serine/threonine protein phosphatase 5 [Solanum torvum] | Back alignment and taxonomy information |
|---|
| >gi|355329952|dbj|BAL14275.1| serine/threonine-protein phosphatase 5 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|224128732|ref|XP_002320408.1| predicted protein [Populus trichocarpa] gi|222861181|gb|EEE98723.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255558752|ref|XP_002520400.1| protein phosphatase-5, putative [Ricinus communis] gi|223540447|gb|EEF42016.1| protein phosphatase-5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18406066|ref|NP_565985.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] gi|16930441|gb|AAL31906.1|AF419574_1 At2g42810/F7D19.19 [Arabidopsis thaliana] gi|20197966|gb|AAD21727.2| putative phosphoprotein phosphatase [Arabidopsis thaliana] gi|33589766|gb|AAQ22649.1| At2g42810/F7D19.19 [Arabidopsis thaliana] gi|330255077|gb|AEC10171.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449444753|ref|XP_004140138.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] gi|449481084|ref|XP_004156077.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357127077|ref|XP_003565212.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|326523823|dbj|BAJ93082.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|79324899|ref|NP_001031534.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] gi|75148953|sp|Q84XU2.1|PPP5_ARATH RecName: Full=Serine/threonine-protein phosphatase 5 gi|28141302|gb|AAO26216.1| type 5 protein serine/threonine phosphatase 60 kDa isoform [Arabidopsis thaliana] gi|330255078|gb|AEC10172.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 485 | ||||||
| TAIR|locus:2052345 | 538 | PP5.2 "protein phosphatase 5.2 | 0.674 | 0.607 | 0.902 | 8.6e-230 | |
| UNIPROTKB|P53041 | 499 | PPP5C "Serine/threonine-protei | 0.979 | 0.951 | 0.571 | 4.2e-150 | |
| UNIPROTKB|F1N719 | 499 | PPP5C "Serine/threonine-protei | 0.979 | 0.951 | 0.571 | 5.4e-150 | |
| UNIPROTKB|F1RM25 | 499 | PPP5C "Serine/threonine-protei | 0.979 | 0.951 | 0.575 | 5.4e-150 | |
| RGD|68415 | 499 | Ppp5c "protein phosphatase 5, | 0.975 | 0.947 | 0.575 | 5.4e-150 | |
| MGI|MGI:102666 | 499 | Ppp5c "protein phosphatase 5, | 0.979 | 0.951 | 0.573 | 6.9e-150 | |
| FB|FBgn0005777 | 520 | PpD3 "Protein phosphatase D3" | 0.964 | 0.9 | 0.568 | 1.8e-149 | |
| ZFIN|ZDB-GENE-050327-75 | 481 | zgc:110801 "zgc:110801" [Danio | 0.985 | 0.993 | 0.564 | 3.9e-147 | |
| WB|WBGene00012665 | 496 | pph-5 [Caenorhabditis elegans | 0.956 | 0.935 | 0.556 | 2.8e-144 | |
| UNIPROTKB|H0YDU8 | 485 | PPP5C "Serine/threonine-protei | 0.950 | 0.950 | 0.564 | 5.3e-143 |
| TAIR|locus:2052345 PP5.2 "protein phosphatase 5.2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1599 (567.9 bits), Expect = 8.6e-230, Sum P(2) = 8.6e-230
Identities = 295/327 (90%), Positives = 314/327 (96%)
Query: 158 EVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDID 217
+VEPQYSGARIEG+ +TLDFVK MM+DFKNQK LHKRYA+QIVLQTR++L ALPSLVDI
Sbjct: 211 KVEPQYSGARIEGEEVTLDFVKTMMEDFKNQKTLHKRYAYQIVLQTRQILLALPSLVDIS 270
Query: 218 IPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFK 277
+P GKH TVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVE+ILTLFAFK
Sbjct: 271 VPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEIILTLFAFK 330
Query: 278 CMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFV 337
CMCPS+IYL+RGNHESKSMNKIYGFEGEVRSKLSE FV+LFAEVFC LPLAHV+N KVFV
Sbjct: 331 CMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVINGKVFV 390
Query: 338 VHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADV 397
VHGGLFSVDGVKLSDI+ IDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFG DV
Sbjct: 391 VHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGGDV 450
Query: 398 TKRFLQDNSLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLK 457
TKRFLQDN+LDL+VRSHEVKDEGYE+EHDGKLITVFSAPNYCDQMGNKGAFIRFEAP +K
Sbjct: 451 TKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDMK 510
Query: 458 PNIVTFAAVPHPDVKPMAYANNFLRMF 484
PNIVTF+AVPHPDVKPMAYANNFLRMF
Sbjct: 511 PNIVTFSAVPHPDVKPMAYANNFLRMF 537
|
|
| UNIPROTKB|P53041 PPP5C "Serine/threonine-protein phosphatase 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N719 PPP5C "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RM25 PPP5C "Serine/threonine-protein phosphatase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|68415 Ppp5c "protein phosphatase 5, catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:102666 Ppp5c "protein phosphatase 5, catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005777 PpD3 "Protein phosphatase D3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050327-75 zgc:110801 "zgc:110801" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012665 pph-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDU8 PPP5C "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XIV2951 | hypothetical protein (488 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 485 | |||
| cd07417 | 316 | cd07417, MPP_PP5_C, PP5, C-terminal metallophospha | 0.0 | |
| smart00156 | 271 | smart00156, PP2Ac, Protein phosphatase 2A homologu | 1e-117 | |
| cd07420 | 321 | cd07420, MPP_RdgC, Drosophila melanogaster RdgC an | 6e-98 | |
| cd07415 | 285 | cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos | 1e-91 | |
| cd07416 | 305 | cd07416, MPP_PP2B, PP2B, metallophosphatase domain | 3e-91 | |
| cd07414 | 293 | cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li | 6e-81 | |
| cd00144 | 225 | cd00144, MPP_PPP_family, phosphoprotein phosphatas | 1e-72 | |
| cd07418 | 377 | cd07418, MPP_PP7, PP7, metallophosphatase domain | 1e-70 | |
| PTZ00239 | 303 | PTZ00239, PTZ00239, serine/threonine protein phosp | 2e-66 | |
| PTZ00244 | 294 | PTZ00244, PTZ00244, serine/threonine-protein phosp | 1e-65 | |
| PTZ00480 | 320 | PTZ00480, PTZ00480, serine/threonine-protein phosp | 2e-63 | |
| cd07419 | 311 | cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho | 8e-59 | |
| pfam08321 | 95 | pfam08321, PPP5, PPP5 TPR repeat region | 3e-42 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-29 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 4e-24 | |
| COG0639 | 155 | COG0639, ApaH, Diadenosine tetraphosphatase and re | 1e-23 | |
| pfam00149 | 185 | pfam00149, Metallophos, Calcineurin-like phosphoes | 1e-21 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 5e-18 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 2e-17 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 1e-14 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 1e-10 | |
| TIGR02552 | 135 | TIGR02552, LcrH_SycD, type III secretion low calci | 6e-10 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 2e-08 | |
| TIGR03302 | 235 | TIGR03302, OM_YfiO, outer membrane assembly lipopr | 5e-08 | |
| COG5010 | 257 | COG5010, TadD, Flp pilus assembly protein TadD, co | 7e-08 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 9e-08 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 2e-07 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 3e-07 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 7e-07 | |
| TIGR03939 | 800 | TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g | 8e-07 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 2e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 2e-06 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 3e-06 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 4e-06 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 5e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 6e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 7e-06 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 9e-06 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 1e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 2e-05 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 2e-05 | |
| cd07423 | 234 | cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela | 2e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 3e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 4e-05 | |
| pfam13371 | 73 | pfam13371, TPR_9, Tetratricopeptide repeat | 4e-05 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 5e-05 | |
| COG4783 | 484 | COG4783, COG4783, Putative Zn-dependent protease, | 7e-05 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 8e-05 | |
| cd07424 | 207 | cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos | 8e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 9e-05 | |
| cd00838 | 131 | cd00838, MPP_superfamily, metallophosphatase super | 1e-04 | |
| cd07425 | 208 | cd07425, MPP_Shelphs, Shewanella-like phosphatases | 1e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 2e-04 | |
| pfam13431 | 34 | pfam13431, TPR_17, Tetratricopeptide repeat | 2e-04 | |
| TIGR02795 | 117 | TIGR02795, tol_pal_ybgF, tol-pal system protein Yb | 2e-04 | |
| PRK13625 | 245 | PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha | 2e-04 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 3e-04 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 4e-04 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 5e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 6e-04 | |
| PRK11788 | 389 | PRK11788, PRK11788, tetratricopeptide repeat prote | 8e-04 | |
| COG4785 | 297 | COG4785, NlpI, Lipoprotein NlpI, contains TPR repe | 9e-04 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 0.001 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 0.001 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 0.001 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 0.001 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 0.002 | |
| PRK15359 | 144 | PRK15359, PRK15359, type III secretion system chap | 0.002 | |
| PRK11189 | 296 | PRK11189, PRK11189, lipoprotein NlpI; Provisional | 0.002 | |
| pfam13181 | 34 | pfam13181, TPR_8, Tetratricopeptide repeat | 0.002 | |
| COG1729 | 262 | COG1729, COG1729, Uncharacterized protein conserve | 0.004 |
| >gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
Score = 654 bits (1689), Expect = 0.0
Identities = 225/316 (71%), Positives = 267/316 (84%)
Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
Y G R+E + +TL+FVK+M++ FK+QK LHK+YA+QI+LQ +E+L+ LPSLV+I IP+G+
Sbjct: 1 YDGPRLEDEKVTLEFVKEMIEWFKDQKKLHKKYAYQILLQVKELLKKLPSLVEITIPEGE 60
Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
TVCGD HGQFYDLLNIFELNGLPSE NPYLFNGDFVDRGSFSVEVILTLFAFK + P+
Sbjct: 61 KITVCGDTHGQFYDLLNIFELNGLPSETNPYLFNGDFVDRGSFSVEVILTLFAFKLLYPN 120
Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
+L+RGNHE+ +MNK+YGFEGEV++K +E +LF+EVF LPLAH++N KV VVHGGL
Sbjct: 121 HFHLNRGNHETDNMNKMYGFEGEVKAKYNEQMFDLFSEVFNWLPLAHLINGKVLVVHGGL 180
Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL 402
FS DGV L DI+ IDRF +PP+ GLMCELLWSDPQP PGR PSKRGVG FG DVTKRFL
Sbjct: 181 FSDDGVTLDDIRKIDRFRQPPDSGLMCELLWSDPQPQPGRSPSKRGVGCQFGPDVTKRFL 240
Query: 403 QDNSLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVT 462
++N+L+ ++RSHEVKDEGYE+EHDGK ITVFSAPNYCDQMGNKGAFIR LKP
Sbjct: 241 EENNLEYIIRSHEVKDEGYEVEHDGKCITVFSAPNYCDQMGNKGAFIRITGSDLKPKFTQ 300
Query: 463 FAAVPHPDVKPMAYAN 478
F AVPHP+VKPMAYAN
Sbjct: 301 FEAVPHPNVKPMAYAN 316
|
Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs. The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 316 |
| >gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|149395 pfam08321, PPP5, PPP5 TPR repeat region | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|205550 pfam13371, TPR_9, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >gnl|CDD|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|185257 PRK15359, PRK15359, type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|224643 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| KOG0372 | 303 | consensus Serine/threonine specific protein phosph | 100.0 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 100.0 | |
| cd07417 | 316 | MPP_PP5_C PP5, C-terminal metallophosphatase domai | 100.0 | |
| KOG0373 | 306 | consensus Serine/threonine specific protein phosph | 100.0 | |
| cd07420 | 321 | MPP_RdgC Drosophila melanogaster RdgC and related | 100.0 | |
| cd07415 | 285 | MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein | 100.0 | |
| KOG0375 | 517 | consensus Serine-threonine phosphatase 2B, catalyt | 100.0 | |
| PTZ00480 | 320 | serine/threonine-protein phosphatase; Provisional | 100.0 | |
| PTZ00239 | 303 | serine/threonine protein phosphatase 2A; Provision | 100.0 | |
| cd07416 | 305 | MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca | 100.0 | |
| cd07418 | 377 | MPP_PP7 PP7, metallophosphatase domain. PP7 is a p | 100.0 | |
| KOG0374 | 331 | consensus Serine/threonine specific protein phosph | 100.0 | |
| PTZ00244 | 294 | serine/threonine-protein phosphatase PP1; Provisio | 100.0 | |
| cd07414 | 293 | MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme | 100.0 | |
| smart00156 | 271 | PP2Ac Protein phosphatase 2A homologues, catalytic | 100.0 | |
| KOG0371 | 319 | consensus Serine/threonine protein phosphatase 2A, | 100.0 | |
| cd07419 | 311 | MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a | 100.0 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 100.0 | |
| cd00144 | 225 | MPP_PPP_family phosphoprotein phosphatases of the | 100.0 | |
| cd07425 | 208 | MPP_Shelphs Shewanella-like phosphatases, metallop | 99.92 | |
| PRK13625 | 245 | bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision | 99.91 | |
| cd07413 | 222 | MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat | 99.88 | |
| cd07422 | 257 | MPP_ApaH Escherichia coli ApaH and related protein | 99.87 | |
| PRK00166 | 275 | apaH diadenosine tetraphosphatase; Reviewed | 99.87 | |
| cd07423 | 234 | MPP_PrpE Bacillus subtilis PrpE and related protei | 99.86 | |
| PRK11439 | 218 | pphA serine/threonine protein phosphatase 1; Provi | 99.86 | |
| TIGR00668 | 279 | apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric | 99.85 | |
| cd07424 | 207 | MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do | 99.85 | |
| cd07421 | 304 | MPP_Rhilphs Rhilph phosphatases, metallophosphatas | 99.84 | |
| PHA02239 | 235 | putative protein phosphatase | 99.82 | |
| PRK09968 | 218 | serine/threonine-specific protein phosphatase 2; P | 99.79 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.73 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.72 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.67 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.65 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.58 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.53 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.53 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.52 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.51 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.49 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.49 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.48 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.45 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.45 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.45 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.42 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.42 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.41 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.4 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.4 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.4 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.38 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.38 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.37 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.36 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.34 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.33 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.32 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.32 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.32 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.31 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.3 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.3 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.29 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.29 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.28 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.27 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.27 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.25 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.23 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.22 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.21 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.21 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.19 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.19 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.19 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.19 | |
| PF00149 | 200 | Metallophos: Calcineurin-like phosphoesterase; Int | 99.19 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.18 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.16 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.16 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.16 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.15 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.14 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.14 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.12 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.12 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.11 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.1 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.1 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.09 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.09 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.09 | |
| COG0639 | 155 | ApaH Diadenosine tetraphosphatase and related seri | 99.09 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.09 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.08 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.08 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.08 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.07 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.05 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.04 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.02 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.01 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.01 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.01 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.0 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.99 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.98 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.97 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.97 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.96 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.95 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.95 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.94 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.93 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.92 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.92 | |
| cd00841 | 155 | MPP_YfcE Escherichia coli YfcE and related protein | 98.88 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.86 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.86 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.85 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.85 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.84 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.84 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.81 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.79 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.78 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.78 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.77 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.77 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.77 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.76 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.76 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.76 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.76 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.75 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.74 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.74 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.74 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.74 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.72 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.72 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.71 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.71 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.7 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.7 | |
| PF12850 | 156 | Metallophos_2: Calcineurin-like phosphoesterase su | 98.7 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.7 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.68 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.68 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.67 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.66 | |
| cd07397 | 238 | MPP_DevT Myxococcus xanthus DevT and related prote | 98.65 | |
| TIGR00040 | 158 | yfcE phosphoesterase, MJ0936 family. Members of th | 98.64 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.63 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.62 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.62 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.62 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.61 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.6 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.6 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.6 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.6 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.58 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.55 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.55 | |
| cd07379 | 135 | MPP_239FB Homo sapiens 239FB and related proteins, | 98.54 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.54 | |
| PRK09453 | 182 | phosphodiesterase; Provisional | 98.53 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.52 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.51 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.51 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.49 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.49 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.49 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.47 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.47 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.45 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.45 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.45 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.43 | |
| PF08321 | 95 | PPP5: PPP5 TPR repeat region; InterPro: IPR013235 | 98.42 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.42 | |
| cd00838 | 131 | MPP_superfamily metallophosphatase superfamily, me | 98.39 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.38 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.38 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.35 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.35 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.34 | |
| cd07394 | 178 | MPP_Vps29 Homo sapiens Vps29 and related proteins, | 98.32 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.3 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.29 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.28 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.27 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.27 | |
| cd07388 | 224 | MPP_Tt1561 Thermus thermophilus Tt1561 and related | 98.24 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.2 | |
| cd07404 | 166 | MPP_MS158 Microscilla MS158 and related proteins, | 98.2 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.2 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.2 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.19 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.18 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.13 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.13 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.1 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.06 | |
| PRK05340 | 241 | UDP-2,3-diacylglucosamine hydrolase; Provisional | 98.04 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.02 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.02 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.01 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.01 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.96 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.94 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.94 | |
| TIGR01854 | 231 | lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. | 97.93 | |
| cd07403 | 129 | MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel | 97.93 | |
| cd07399 | 214 | MPP_YvnB Bacillus subtilis YvnB and related protei | 97.92 | |
| cd07392 | 188 | MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel | 97.91 | |
| COG0622 | 172 | Predicted phosphoesterase [General function predic | 97.89 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.83 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.8 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.78 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.78 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.76 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.75 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.74 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.73 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.7 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.67 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.66 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.65 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.65 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.64 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.62 | |
| cd07400 | 144 | MPP_YydB Bacillus subtilis YydB and related protei | 97.6 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.6 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.59 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.58 | |
| cd07395 | 262 | MPP_CSTP1 Homo sapiens CSTP1 and related proteins, | 97.55 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.54 | |
| cd07383 | 199 | MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase | 97.51 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.51 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.49 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.49 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.46 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.45 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.41 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.41 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.36 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.36 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.33 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.29 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.29 | |
| PRK11340 | 271 | phosphodiesterase YaeI; Provisional | 97.28 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.27 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.25 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.25 | |
| cd07391 | 172 | MPP_PF1019 Pyrococcus furiosus PF1019 and related | 97.23 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.21 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.2 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.19 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.19 | |
| PF06874 | 640 | FBPase_2: Firmicute fructose-1,6-bisphosphatase; I | 97.17 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.16 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.14 | |
| cd07385 | 223 | MPP_YkuE_C Bacillus subtilis YkuE and related prot | 97.13 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.13 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.08 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 97.07 | |
| cd07398 | 217 | MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat | 97.07 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 97.07 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.06 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 97.03 | |
| cd07384 | 171 | MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re | 97.03 | |
| cd07390 | 168 | MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro | 97.02 | |
| PRK04036 | 504 | DNA polymerase II small subunit; Validated | 97.01 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.97 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 96.95 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.91 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.89 | |
| TIGR03729 | 239 | acc_ester putative phosphoesterase. Members of thi | 96.89 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.87 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.85 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.81 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.79 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.72 | |
| cd00844 | 262 | MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t | 96.72 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.71 | |
| cd07396 | 267 | MPP_Nbla03831 Homo sapiens Nbla03831 and related p | 96.68 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.67 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 96.63 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 96.62 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.6 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.57 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.54 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.51 | |
| COG1409 | 301 | Icc Predicted phosphohydrolases [General function | 96.51 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.51 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.51 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.5 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.48 | |
| cd08163 | 257 | MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related | 96.48 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 96.45 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.45 | |
| TIGR00619 | 253 | sbcd exonuclease SbcD. This family is based on the | 96.42 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.41 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.37 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.36 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.34 | |
| cd07402 | 240 | MPP_GpdQ Enterobacter aerogenes GpdQ and related p | 96.31 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.28 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.28 | |
| PRK11148 | 275 | cyclic 3',5'-adenosine monophosphate phosphodieste | 96.26 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.26 | |
| cd08166 | 195 | MPP_Cdc1_like_1 uncharacterized subgroup related t | 96.21 | |
| PHA02546 | 340 | 47 endonuclease subunit; Provisional | 96.2 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.16 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 96.13 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 96.08 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.07 | |
| cd07393 | 232 | MPP_DR1119 Deinococcus radiodurans DR1119 and rela | 96.04 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.04 | |
| KOG0918 | 476 | consensus Selenium-binding protein [Inorganic ion | 96.03 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.96 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 95.92 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 95.87 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 95.85 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.84 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.84 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 95.83 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 95.83 | |
| cd00840 | 223 | MPP_Mre11_N Mre11 nuclease, N-terminal metallophos | 95.8 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.76 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.76 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 95.76 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 95.75 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 95.74 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 95.5 | |
| cd08165 | 156 | MPP_MPPE1 human MPPE1 and related proteins, metall | 95.49 | |
| TIGR00024 | 225 | SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 | 95.43 | |
| PRK10966 | 407 | exonuclease subunit SbcD; Provisional | 95.38 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 95.27 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 95.21 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 95.14 | |
| cd07380 | 150 | MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re | 95.1 | |
| TIGR00583 | 405 | mre11 DNA repair protein (mre11). All proteins in | 95.05 | |
| cd00839 | 294 | MPP_PAPs purple acid phosphatases of the metalloph | 94.94 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 94.88 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 94.76 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 94.74 | |
| COG1407 | 235 | Predicted ICC-like phosphoesterases [General funct | 94.71 | |
| COG4186 | 186 | Predicted phosphoesterase or phosphohydrolase [Gen | 94.7 | |
| cd08164 | 193 | MPP_Ted1 Saccharomyces cerevisiae Ted1 and related | 94.67 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 94.63 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 94.49 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 94.38 | |
| cd07401 | 256 | MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal | 94.35 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 94.33 | |
| COG2908 | 237 | Uncharacterized protein conserved in bacteria [Fun | 94.3 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.97 | |
| cd07386 | 243 | MPP_DNA_pol_II_small_archeal_C archeal DNA polymer | 93.94 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 93.92 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 93.87 | |
| cd00845 | 252 | MPP_UshA_N_like Escherichia coli UshA-like family, | 93.87 | |
| COG1408 | 284 | Predicted phosphohydrolases [General function pred | 93.7 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.69 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 93.65 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 93.63 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 93.56 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 93.55 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 93.44 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 93.39 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 93.38 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 93.36 | |
| KOG3325 | 183 | consensus Membrane coat complex Retromer, subunit | 93.22 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 93.07 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 93.03 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 92.99 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 92.97 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 92.81 | |
| KOG3662 | 410 | consensus Cell division control protein/predicted | 92.67 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 92.6 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 92.52 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 92.52 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 92.27 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 92.15 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 92.05 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 91.96 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 91.96 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 91.8 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 91.78 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 91.63 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 91.61 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 91.59 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 91.48 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 91.35 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 91.27 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 91.22 | |
| cd07378 | 277 | MPP_ACP5 Homo sapiens acid phosphatase 5 and relat | 90.92 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 90.86 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 90.83 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.54 | |
| cd07410 | 277 | MPP_CpdB_N Escherichia coli CpdB and related prote | 90.09 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 90.04 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 90.02 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 89.93 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 89.83 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 89.71 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 89.67 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 89.45 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 89.43 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 89.29 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 89.23 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 88.51 | |
| COG2129 | 226 | Predicted phosphoesterases, related to the Icc pro | 88.45 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 88.28 | |
| COG0420 | 390 | SbcD DNA repair exonuclease [DNA replication, reco | 88.24 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 88.24 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 88.22 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 88.2 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 88.14 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 88.01 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 87.92 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 87.83 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 87.69 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 87.68 | |
| KOG3807 | 556 | consensus Predicted membrane protein ST7 (tumor su | 87.3 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 87.04 | |
| cd07412 | 288 | MPP_YhcR_N Bacillus subtilis YhcR endonuclease and | 86.98 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 86.97 | |
| cd07408 | 257 | MPP_SA0022_N Staphylococcus aureus SA0022 and rela | 86.78 | |
| PLN02533 | 427 | probable purple acid phosphatase | 86.71 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 85.97 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 85.92 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 85.81 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 85.8 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 84.97 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 84.75 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 84.74 | |
| COG3855 | 648 | Fbp Uncharacterized protein conserved in bacteria | 84.38 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 83.49 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 83.29 | |
| PF14582 | 255 | Metallophos_3: Metallophosphoesterase, calcineurin | 83.17 | |
| cd07411 | 264 | MPP_SoxB_N Thermus thermophilus SoxB and related p | 82.87 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 82.57 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 82.53 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 81.57 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 81.39 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 81.3 | |
| cd07409 | 281 | MPP_CD73_N CD73 ecto-5'-nucleotidase and related p | 81.15 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 80.56 | |
| COG4941 | 415 | Predicted RNA polymerase sigma factor containing a | 80.49 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 80.26 | |
| COG1768 | 230 | Predicted phosphohydrolase [General function predi | 80.11 |
| >KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-87 Score=587.75 Aligned_cols=284 Identities=42% Similarity=0.753 Sum_probs=275.4
Q ss_pred HHHHHHhhhhcccchHHHHHHHHHHHHHHhhcCCCcceecCCCCCceeEecccCCCHHHHHHHHHHcCCCCCCCCeEEcc
Q 011451 178 VKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNG 257 (485)
Q Consensus 178 l~~lie~l~~~~~l~~~~~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~dl~~il~~~~~~~~~~~~vflG 257 (485)
+++.++.+++...+.+.++..+|.+++++|.+|+++..++.| +.|+||||||+.||+.+|+..|-++++ +|+|||
T Consensus 3 ldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tP----vtvcGDIHGQf~Dllelf~igG~~~~t-~YLFLG 77 (303)
T KOG0372|consen 3 LDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTP----VTVCGDIHGQFYDLLELFRIGGDVPET-NYLFLG 77 (303)
T ss_pred HHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCC----cEEeecccchHHHHHHHHHhCCCCCCC-ceEeec
Confidence 677889999999999999999999999999999999999987 999999999999999999998887766 599999
Q ss_pred cccCCCCChHHHHHHHHhchhcCCCcEEEeccCCCccccccccCchhHHHhhhc-HHHHHHHHHHhccccccceeCCcEE
Q 011451 258 DFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLS-ETFVELFAEVFCCLPLAHVLNQKVF 336 (485)
Q Consensus 258 D~vdrG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~-~~~~~~~~~~f~~lPl~~~i~~~~~ 336 (485)
||||||.+|+|+++||++||++||++|+|||||||++.++..|||++||.+||| ..+|+.++++|+.||++|+|++++|
T Consensus 78 DyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kif 157 (303)
T KOG0372|consen 78 DYVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIF 157 (303)
T ss_pred chhccccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEE
Confidence 999999999999999999999999999999999999999999999999999996 5899999999999999999999999
Q ss_pred EEeCccccCCCCChhhhhhccCCCCCCCCCcccccccCCCCCCCCCCcCCCCCccccCHHHHHHHHHHCCCcEEEeeccc
Q 011451 337 VVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLDLVVRSHEV 416 (485)
Q Consensus 337 ~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iir~h~~ 416 (485)
|||||+ ||.+.++++|+.++|.++.|+++.++|||||||.+..||..||||+|+.||.+++++|++.||+++|+|+||.
T Consensus 158 CVHGGl-SP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~~g~~~SPRGaGylFG~dvv~~F~~~N~~~~I~RaHQL 236 (303)
T KOG0372|consen 158 CVHGGL-SPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEGPGWGLSPRGAGYLFGEDVVESFLEANGLSLICRAHQL 236 (303)
T ss_pred EEcCCC-CcchhhHHHHHHhhccccCCCCCcchheeccCcccCCCcccCCCCccccccHHHHHHHHHhCChHHHHHHHHH
Confidence 999999 9999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCcEEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCC
Q 011451 417 KDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPH 468 (485)
Q Consensus 417 ~~~G~~~~~~~~~~tvfsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~ 468 (485)
+++||++.|+++|+|||||||||+.++|.||||.| +++....|..|++.|.
T Consensus 237 v~eGyk~~F~~~v~TVWSAPNYCYrCGN~AsIl~l-de~~~~~F~vFeaa~~ 287 (303)
T KOG0372|consen 237 VMEGYKWHFDEKVVTVWSAPNYCYRCGNVAAILEL-DEDLDKDFRVFEAAPQ 287 (303)
T ss_pred HHhhHHHhcCCceEEEecCCchhhhcCChHHheee-ccccCcceEeeecchh
Confidence 99999999999999999999999999999999999 8888999999999873
|
|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00480 serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00239 serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >cd07416 MPP_PP2B PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07418 MPP_PP7 PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00244 serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK00166 apaH diadenosine tetraphosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11439 pphA serine/threonine protein phosphatase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) | Back alignment and domain information |
|---|
| >cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PHA02239 putative protein phosphatase | Back alignment and domain information |
|---|
| >PRK09968 serine/threonine-specific protein phosphatase 2; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00040 yfcE phosphoesterase, MJ0936 family | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09453 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase | Back alignment and domain information |
|---|
| >cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG0622 Predicted phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11340 phosphodiesterase YaeI; Provisional | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK04036 DNA polymerase II small subunit; Validated | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >TIGR03729 acc_ester putative phosphoesterase | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >COG1409 Icc Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >TIGR00619 sbcd exonuclease SbcD | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain | Back alignment and domain information |
|---|
| >PHA02546 47 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related | Back alignment and domain information |
|---|
| >PRK10966 exonuclease subunit SbcD; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00583 mre11 DNA repair protein (mre11) | Back alignment and domain information |
|---|
| >cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1407 Predicted ICC-like phosphoesterases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2908 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1408 Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A | Back alignment and domain information |
|---|
| >cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1768 Predicted phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 485 | ||||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 1e-167 | ||
| 1s95_A | 333 | Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 | 1e-119 | ||
| 3h60_A | 315 | Catalytic Domain Of Human SerineTHREONINE PHOSPHATA | 1e-116 | ||
| 3icf_A | 335 | Structure Of Protein SerineTHREONINE PHOSPHATASE FR | 7e-77 | ||
| 2o8a_A | 329 | Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng | 2e-59 | ||
| 1jk7_A | 323 | Crystal Structure Of The Tumor-Promoter Okadaic Aci | 2e-59 | ||
| 1fjm_A | 330 | Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor | 2e-59 | ||
| 4g9j_A | 331 | Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P | 2e-59 | ||
| 3n5u_B | 300 | Crystal Structure Of An Rb C-Terminal Peptide Bound | 2e-59 | ||
| 3egg_A | 329 | Crystal Structure Of A Complex Between Protein Phos | 3e-59 | ||
| 3v4y_A | 306 | Crystal Structure Of The First Nuclear Pp1 Holoenzy | 3e-59 | ||
| 3e7a_A | 299 | Crystal Structure Of Protein Phosphatase-1 Bound To | 4e-59 | ||
| 1u32_A | 293 | Crystal Structure Of A Protein Phosphatase-1: Calci | 2e-58 | ||
| 1s70_A | 330 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 7e-58 | ||
| 1aui_A | 521 | Human Calcineurin Heterodimer Length = 521 | 7e-57 | ||
| 1m63_A | 372 | Crystal Structure Of Calcineurin-Cyclophilin-Cyclos | 2e-56 | ||
| 1mf8_A | 373 | Crystal Structure Of Human Calcineurin Complexed Wi | 2e-56 | ||
| 1tco_A | 375 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 2e-56 | ||
| 2p6b_A | 383 | Crystal Structure Of Human Calcineurin In Complex W | 2e-56 | ||
| 3ll8_A | 357 | Crystal Structure Of Calcineurin In Complex With Ak | 2e-56 | ||
| 2jog_A | 327 | Structure Of The Calcineurin-Nfat Complex Length = | 3e-56 | ||
| 3p71_C | 304 | Crystal Structure Of The Complex Of Lcmt-1 And Pp2a | 4e-54 | ||
| 2nyl_C | 293 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 3e-53 | ||
| 2ie4_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 4e-53 | ||
| 2ie3_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 4e-53 | ||
| 3c5w_C | 310 | Complex Between Pp2a-Specific Methylesterase Pme-1 | 4e-53 | ||
| 2iae_C | 309 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 1e-52 | ||
| 3fga_C | 309 | Structural Basis Of Pp2a And Sgo Interaction Length | 1e-52 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 5e-41 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 7e-33 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 9e-17 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 3e-16 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 3e-13 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 8e-13 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 1e-12 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 4e-12 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 1e-11 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 2e-11 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 3e-11 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 4e-11 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 1e-10 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 2e-10 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 5e-10 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 8e-10 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 2e-08 | ||
| 2gw1_A | 514 | Crystal Structure Of The Yeast Tom70 Length = 514 | 2e-08 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 3e-08 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 7e-05 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 3e-08 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 7e-05 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 5e-08 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 1e-07 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 2e-07 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 2e-06 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 3e-06 | ||
| 2avp_A | 70 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 6e-05 | ||
| 2avp_A | 70 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 8e-05 | ||
| 3pe3_A | 723 | Structure Of Human O-Glcnac Transferase And Its Com | 7e-05 | ||
| 2fbn_A | 198 | Plasmodium Falciparum Putative Fk506-Binding Protei | 1e-04 | ||
| 4gcn_A | 127 | N-Terminal Domain Of Stress-Induced Protein-1 (Sti- | 1e-04 | ||
| 1elr_A | 131 | Crystal Structure Of The Tpr2a Domain Of Hop In Com | 2e-04 | ||
| 3esk_A | 129 | Structure Of Hop Tpr2a Domain In Complex With The N | 3e-04 | ||
| 2l6j_A | 111 | Tah1 Complexed By Meevd Length = 111 | 5e-04 |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
|
| >pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 | Back alignment and structure |
| >pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 | Back alignment and structure |
| >pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 | Back alignment and structure |
| >pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 | Back alignment and structure |
| >pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 | Back alignment and structure |
| >pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 | Back alignment and structure |
| >pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 | Back alignment and structure |
| >pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 | Back alignment and structure |
| >pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 | Back alignment and structure |
| >pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 | Back alignment and structure |
| >pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 | Back alignment and structure |
| >pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 | Back alignment and structure |
| >pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 | Back alignment and structure |
| >pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 | Back alignment and structure |
| >pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 | Back alignment and structure |
| >pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 | Back alignment and structure |
| >pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 | Back alignment and structure |
| >pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 | Back alignment and structure |
| >pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 | Back alignment and structure |
| >pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 | Back alignment and structure |
| >pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 | Back alignment and structure |
| >pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 | Back alignment and structure |
| >pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 | Back alignment and structure |
| >pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 | Back alignment and structure |
| >pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 | Back alignment and structure |
| >pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 | Back alignment and structure |
| >pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 | Back alignment and structure |
| >pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 | Back alignment and structure |
| >pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 | Back alignment and structure |
| >pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 | Back alignment and structure |
| >pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 | Back alignment and structure |
| >pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 | Back alignment and structure |
| >pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 485 | |||
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 0.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 0.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 0.0 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 1e-119 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 1e-114 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 1e-112 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 1e-109 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 1e-108 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 3e-70 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 6e-57 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 2e-55 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 5e-55 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 7e-55 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 6e-17 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 8e-55 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 2e-54 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 9e-53 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 1e-52 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 1e-51 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 3e-47 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 2e-44 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 4e-41 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 7e-39 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 9e-39 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-38 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-33 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-29 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-19 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-18 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-16 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-37 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-31 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-29 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-19 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 6e-19 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-18 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-08 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 8e-36 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 1e-35 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-30 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-25 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-23 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-17 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-34 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-27 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-26 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-26 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-25 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-21 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 9e-21 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-13 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 9e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-04 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-30 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-25 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-22 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-20 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-20 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-19 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 2e-29 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 4e-16 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 6e-27 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-26 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-26 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-23 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-20 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-15 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 4e-07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 9e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 2e-25 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 3e-13 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 3e-25 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 1e-15 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 4e-23 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 4e-22 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-15 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 7e-11 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-21 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-17 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-12 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 4e-24 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 8e-24 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 3e-23 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 2e-19 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 8e-13 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 9e-08 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-23 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-20 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-17 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-16 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-22 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-21 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-20 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 9e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-17 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-16 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-14 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-09 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 2e-22 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-21 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 7e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-22 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-19 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-19 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-18 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-17 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-16 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 3e-22 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 8e-21 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 7e-17 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 5e-22 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 8e-20 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 9e-19 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-13 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-10 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 5e-22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 3e-17 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 2e-21 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 3e-21 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 7e-20 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 8e-14 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-21 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 9e-18 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-17 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-20 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-19 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 9e-19 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 8e-16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-15 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-15 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 4e-20 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-18 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 7e-17 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-16 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-10 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 4e-20 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 1e-13 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 1e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 8e-19 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 9e-19 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-16 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-16 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-14 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 5e-18 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-17 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 4e-12 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-08 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 6e-18 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 1e-15 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 3e-15 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 7e-13 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 1e-17 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-14 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 4e-09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 3e-08 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 3e-17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-15 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 3e-15 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-14 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 9e-17 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 1e-09 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 2e-16 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-15 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 7e-14 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 7e-12 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 2e-16 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 1e-11 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 9e-16 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 5e-08 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 6e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-15 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-14 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-13 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-10 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 5e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-06 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 4e-15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 5e-15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 3e-12 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 6e-04 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 1e-14 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 2e-14 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 3e-11 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 1e-05 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 4e-13 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 1e-12 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 1e-08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 3e-06 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 7e-13 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 1e-12 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 1e-12 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 3e-11 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 1e-11 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 2e-10 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 2e-07 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 1e-10 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-09 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-06 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 3e-05 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 1e-04 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 5e-09 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-06 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 1e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-04 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 2e-08 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 5e-08 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 6e-08 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-07 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 3e-06 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-04 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 2e-07 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-07 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 3e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 2e-07 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 3e-06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 8e-06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 1e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 6e-04 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 3e-07 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 6e-07 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 3e-04 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 7e-07 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 6e-06 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 2e-05 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 6e-05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 4e-05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 2e-04 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 6e-05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 5e-04 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 9e-05 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 1e-04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 1e-04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 8e-04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 2e-04 |
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
Score = 763 bits (1971), Expect = 0.0
Identities = 272/476 (57%), Positives = 356/476 (74%), Gaps = 1/476 (0%)
Query: 9 SSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAI 68
++ RAEELK AN+ F+AK Y AI YSQAIELN NA+YY NR+ A+ + E YG A+
Sbjct: 1 GALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYAL 60
Query: 69 QDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKA 128
DA++AIE+D +Y KGYYRR A+ +A+GKF+ AL+D++ V K+ P+D DA K +EC K
Sbjct: 61 GDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI 120
Query: 129 VKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQ 188
VK+ FE AIA E +R SV DS+D +S+ +E +YSG ++E +T+ F+K++M +K+Q
Sbjct: 121 VKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQ 179
Query: 189 KCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPS 248
K LH++ A+QI++Q +E+L L +LV+ + + + TVCGD HGQFYDLLNIFELNGLPS
Sbjct: 180 KKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPS 239
Query: 249 EENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRS 308
E NPY+FNGDFVDRGSFSVEVILTLF FK + P +L RGNHE+ +MN+IYGFEGEV++
Sbjct: 240 ETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKA 299
Query: 309 KLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLM 368
K + ELF+EVF LPLA +N KV ++HGGLFS DGV L DI+ I+R +PP+ G M
Sbjct: 300 KYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPM 359
Query: 369 CELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLDLVVRSHEVKDEGYEIEHDGK 428
C+LLWSDPQP GR SKRGV FG DVTK FL++N+LD ++RSHEVK EGYE+ H G+
Sbjct: 360 CDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGR 419
Query: 429 LITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMF 484
+TVFSAPNYCDQMGNK ++I + L+P F AVPHP+VKPMAYAN L++
Sbjct: 420 CVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLG 475
|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Length = 261 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Length = 225 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 100.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 100.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 100.0 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 100.0 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 100.0 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 100.0 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 100.0 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 100.0 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 100.0 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 99.97 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 99.88 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.83 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 99.81 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.76 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.74 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.74 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.73 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.73 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.73 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.73 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.72 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.71 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.7 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.69 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.69 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.69 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.69 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.69 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.69 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.68 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.67 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.66 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.65 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.65 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.63 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.63 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.63 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.62 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.62 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.62 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.61 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.61 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.61 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.6 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 99.6 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.6 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.58 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.58 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.58 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 99.57 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.57 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.57 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.57 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.57 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.55 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.55 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.54 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.54 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.54 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.54 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.53 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.53 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.53 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.53 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.53 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.52 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.52 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.52 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.52 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.52 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.51 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.5 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.5 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.5 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.5 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.5 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.49 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.49 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.49 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.49 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.49 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.49 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.49 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.49 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.49 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.48 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.48 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.48 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.48 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.47 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.47 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.46 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.46 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.46 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.45 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.45 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.44 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.44 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.44 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.42 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 99.42 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.41 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.4 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.38 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.37 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.37 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.37 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.36 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.36 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.35 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.35 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.35 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.34 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.34 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.33 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.33 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.33 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.33 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.33 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.32 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.32 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.31 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.3 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.3 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.3 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.28 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.28 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.28 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.28 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.28 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.26 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.26 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.25 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.24 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.24 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.24 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.23 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.22 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.21 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.2 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.2 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.2 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.19 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.18 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.18 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.18 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.17 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.17 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.17 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.17 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.15 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.15 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.15 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.14 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.13 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.13 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.13 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.13 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.12 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.12 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.12 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.11 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.11 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.11 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.1 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.1 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.1 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.1 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.09 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.07 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.07 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.06 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.06 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.05 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.05 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.04 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.03 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.03 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.03 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.02 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.02 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.01 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.01 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.97 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.95 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.95 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.94 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.94 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.92 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.9 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.89 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.88 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.88 | |
| 1s3l_A | 190 | Hypothetical protein MJ0936; phosphodiesterase, nu | 98.86 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.85 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.78 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.77 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.76 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.74 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.7 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.69 | |
| 1uf3_A | 228 | Hypothetical protein TT1561; metallo-dependent pho | 98.68 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.66 | |
| 3ck2_A | 176 | Conserved uncharacterized protein (predicted phosp | 98.65 | |
| 2kkn_A | 178 | Uncharacterized protein; protein phosphatase 2A ho | 98.64 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.64 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.63 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.63 | |
| 2a22_A | 215 | Vacuolar protein sorting 29; alpha-beta-BETA-alpha | 98.62 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.62 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.61 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.61 | |
| 1su1_A | 208 | Hypothetical protein YFCE; structural genomics, ph | 98.6 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.59 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.58 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.57 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.56 | |
| 1z2w_A | 192 | Vacuolar protein sorting 29; VPS29, retromer, phos | 98.52 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.44 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.43 | |
| 1xm7_A | 195 | Hypothetical protein AQ_1665; structural genomics, | 98.4 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.35 | |
| 3ib7_A | 330 | ICC protein; metallophosphoesterase, alpha-beta fo | 98.34 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.32 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.28 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.27 | |
| 3d03_A | 274 | Phosphohydrolase; glycerophosphodiesterase, metall | 98.26 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.23 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.21 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.2 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.18 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.16 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.13 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.13 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.88 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.84 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.83 | |
| 2nxf_A | 322 | Putative dimetal phosphatase; dinuclear metal cent | 97.79 | |
| 2yvt_A | 260 | Hypothetical protein AQ_1956; structural genomics, | 97.77 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.7 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.68 | |
| 3rl5_A | 296 | Metallophosphoesterase mpped2; alpha-beta fold, me | 97.67 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.65 | |
| 2xmo_A | 443 | LMO2642 protein; phosphodiesterase, hydrolase; 1.7 | 97.59 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.56 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 97.51 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.46 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.33 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.04 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.02 | |
| 3av0_A | 386 | DNA double-strand break repair protein MRE11; DNA | 96.68 | |
| 2q8u_A | 336 | Exonuclease, putative; structural genomics, joint | 96.6 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.6 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 96.57 | |
| 1ii7_A | 333 | MRE11 nuclease; RAD50, DNA double-strand break rep | 96.51 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 96.48 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.79 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.71 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 95.68 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.38 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.34 | |
| 4fbk_A | 472 | DNA repair and telomere maintenance protein NBS1, | 95.3 | |
| 4fbw_A | 417 | DNA repair protein RAD32; DNA double-strand break | 95.23 | |
| 3t1i_A | 431 | Double-strand break repair protein MRE11A; DNA rep | 95.13 | |
| 3tho_B | 379 | Exonuclease, putative; adenosine triphosphate, bac | 95.06 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 95.05 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.03 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 94.77 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 94.57 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.54 | |
| 1ute_A | 313 | Protein (II purple acid phosphatase); tartrate res | 94.07 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 93.89 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 93.66 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 93.25 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 93.1 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 92.64 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 92.42 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.23 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 91.11 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 90.37 | |
| 3tgh_A | 342 | Glideosome-associated protein 50; phosphatase fold | 89.72 | |
| 3qfk_A | 527 | Uncharacterized protein; structural genomics, cent | 88.73 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 88.3 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 88.28 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 87.92 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 86.75 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 85.82 | |
| 2z1a_A | 552 | 5'-nucleotidase; metal-binding, nucleotide-binding | 85.41 | |
| 1hp1_A | 516 | 5'-nucleotidase; metallophosphatase, dinuclear, me | 85.01 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 84.32 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 82.07 | |
| 4h2g_A | 546 | 5'-nucleotidase; dimer, hydrolase, phosphatase, ex | 80.33 |
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.8e-92 Score=733.69 Aligned_cols=471 Identities=58% Similarity=0.999 Sum_probs=441.3
Q ss_pred chhHHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCChHHHHHHH
Q 011451 10 SVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRG 89 (485)
Q Consensus 10 ~~~~a~~~~~lg~~~~~~g~~~~A~~~y~~al~~~p~~~~~~~~lg~~~~~~g~~~eAl~~~~~al~~~p~~~~~~~~lg 89 (485)
.++.+.+++.+|..++.+|++++|++.|++|++++|+++.++.++|.++..+|++++|++++++|++++|+++.+++++|
T Consensus 2 ~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg 81 (477)
T 1wao_1 2 ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRA 81 (477)
T ss_dssp CHHHHTTSSSSSSSTTTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHH
T ss_pred hHhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence 46778889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHhhhhHHHhhcCCccccccccccccccccccCCCCCCcccc
Q 011451 90 AAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIE 169 (485)
Q Consensus 90 ~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~A~~~~~~~~~~~a~~~~~~~l~~~~~~~~~~l~ 169 (485)
.+|..+|++++|++.|+++++++|+++.++..++.+.....++++++|+..++... ........++++++|.+.++.+.
T Consensus 82 ~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~~-~~~~~~~~~al~~~~~~~~~~~~ 160 (477)
T 1wao_1 82 ASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLE 160 (477)
T ss_dssp HHHHHHTCHHHHHHHHHHHHHHSTTCTTHHHHHHHHHHHHHHHHHCCC------CC-STTTCCTTSSCCCCTTCCSCCCG
T ss_pred HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHhccccccc-hhHhhhhhhhccccccccccccc
Confidence 99999999999999999999999999999999999966677777899999887432 22334455888999999999888
Q ss_pred CCcccHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHhhcCCCcceecCCCCCceeEecccCCCHHHHHHHHHHcCCCCC
Q 011451 170 GDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSE 249 (485)
Q Consensus 170 ~~~l~~~~l~~lie~l~~~~~l~~~~~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~dl~~il~~~~~~~~ 249 (485)
...++...++.+++.++....+++.++..++.++.+++.++|+++++..|.+.+++|+|||||++.+|.++|+..++++.
T Consensus 161 ~~~itl~~l~~lie~l~~~~~l~e~~v~~L~~~a~eil~~e~~~~~~~~~~~~~~~vigDiHG~~~~l~~~l~~~~~~~~ 240 (477)
T 1wao_1 161 DGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSE 240 (477)
T ss_dssp GGSCCHHHHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCSSCEEEEECBCTTCHHHHHHHHHHHCCCBT
T ss_pred cccccHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHccCCCeEEeecCCCcceEEEeCCCCCHHHHHHHHHHcCCCCC
Confidence 76688999999999999999999999999999999999999999999988888899999999999999999999999877
Q ss_pred CCCeEEcccccCCCCChHHHHHHHHhchhcCCCcEEEeccCCCccccccccCchhHHHhhhcHHHHHHHHHHhccccccc
Q 011451 250 ENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAH 329 (485)
Q Consensus 250 ~~~~vflGD~vdrG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~~~~~~~~~~~f~~lPl~~ 329 (485)
.+.|||+|||||||++|+||+.+|++||+.+|.+|++||||||.+.++..|||..|+.++|+..+|..+.++|++||+++
T Consensus 241 ~~~~v~lGD~vdrG~~s~e~~~~l~~l~~~~~~~~~~lrGNHE~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~lp~~~ 320 (477)
T 1wao_1 241 TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQ 320 (477)
T ss_dssp TBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCTTHHHHHHHHHTTSCSEE
T ss_pred cCeEEEeccccCCCcchHHHHHHHHHHHhhCCCceEeecCCccHHHHhhhcChHHHHHHHhhHHHHHHHHHHhccCCcEE
Confidence 77799999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeCCcEEEEeCccccCCCCChhhhhhccCCCCCCCCCcccccccCCCCCCCCCCcCCCCCccccCHHHHHHHHHHCCCcE
Q 011451 330 VLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLDL 409 (485)
Q Consensus 330 ~i~~~~~~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~ 409 (485)
++++++||||||+|+|...++++|+++.|+.++++.+.++|+|||||....++.+++||.|+.||++++++||+++|+++
T Consensus 321 ~~~~~~~~vHgg~~~~~~~~l~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~ 400 (477)
T 1wao_1 321 CINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDY 400 (477)
T ss_dssp EETTTEEECSSCCCSSSCCCHHHHHTCCCSSCCCSSSHHHHHHHCEECSSSSCEECTTSSSEEECHHHHHHHHHHTTCCE
T ss_pred EEcCcEEEECCCCCccccCCHHHHHhccCCCCCchhhhhhhhccCCCCccCCcCcCCCCCceeECHHHHHHHHHHcCCeE
Confidence 99999999999998888899999999999999999999999999999998899999999999999999999999999999
Q ss_pred EEeeccccccCcEEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCCCCCCCccccchhh
Q 011451 410 VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFL 481 (485)
Q Consensus 410 iir~h~~~~~G~~~~~~~~~~tvfsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 481 (485)
||||||++++||+++++++|||||||||||+.++|.||+|.|++++++++|++|+++|+|.++||+||.+++
T Consensus 401 iir~H~~~~~g~~~~~~~~~~tvfsa~~y~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 472 (477)
T 1wao_1 401 IIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLL 472 (477)
T ss_dssp EEECCSCCTEEEEEEGGGTEEEEBCCTTTTSSSCCEEEEEEEETTEEEEEEEEECCCCCCSCCTTCSSCHHH
T ss_pred EEECCCCCcCCeEEecCCeEEEEeCCcccccCCCccEEEEEEECCCCeEEEEEEeCCCCCCCChhhhhhhhh
Confidence 999999999999999999999999999999999999999999767899999999999999999999998887
|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 | Back alignment and structure |
|---|
| >2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* | Back alignment and structure |
|---|
| >2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* | Back alignment and structure |
|---|
| >4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* | Back alignment and structure |
|---|
| >3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 | Back alignment and structure |
|---|
| >1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 485 | ||||
| d1s95a_ | 324 | d.159.1.3 (A:) Serine/threonine protein phosphatas | 1e-141 | |
| d1auia_ | 473 | d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc | 1e-105 | |
| d3c5wc1 | 288 | d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt | 7e-99 | |
| d1jk7a_ | 294 | d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human | 5e-93 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 4e-29 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 8e-23 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 4e-08 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 4e-20 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 4e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-16 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 6e-15 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-08 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.002 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.002 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.004 | |
| d1g5ba_ | 219 | d.159.1.3 (A:) lambda ser/thr protein phosphatase | 3e-16 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 7e-16 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 7e-16 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 2e-15 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 2e-14 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 4e-14 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 5e-13 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 5e-06 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 1e-12 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 9e-11 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 4e-07 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-06 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 6e-06 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-04 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 2e-09 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 3e-05 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 0.004 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 6e-09 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 4e-06 | |
| d1nnwa_ | 251 | d.159.1.5 (A:) Hypothetical protein PF1291 {Archae | 3e-08 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 1e-07 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 7e-06 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 3e-05 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 1e-04 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 4e-04 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 2e-07 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 2e-07 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 1e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 3e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 2e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 3e-07 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 5e-06 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 1e-05 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 7e-07 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 7e-05 | |
| d1tjca_ | 95 | a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni | 3e-06 | |
| d1nzna_ | 122 | a.118.8.1 (A:) Mitochondria fission protein Fis1 { | 2e-04 | |
| d1su1a_ | 184 | d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia | 0.001 | |
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 0.003 |
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Serine/threonine protein phosphatase 5, PP5 species: Human (Homo sapiens) [TaxId: 9606]
Score = 406 bits (1044), Expect = e-141
Identities = 192/322 (59%), Positives = 246/322 (76%)
Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
YSG ++E +T+ F+K++M +K+QK LH++ A+QI++Q +E+L L +LV+ + + +
Sbjct: 1 YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETE 60
Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
TVCGD HGQFYDLLNIFELNGLPSE NPY+FNGDFVDRGSFSVEVILTLF FK + P
Sbjct: 61 KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPD 120
Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
+L RGNHE+ +MN+IYGFEGEV++K + ELF+EVF LPLA +N KV ++HGGL
Sbjct: 121 HFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGL 180
Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL 402
FS DGV L DI+ I+R +PP+ G MC+LLWSDPQP GR SKRGV FG DVTK FL
Sbjct: 181 FSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL 240
Query: 403 QDNSLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVT 462
++N+LD ++RSHEVK EGYE+ H G+ +TVFSAPNYCDQMGNK ++I + L+P
Sbjct: 241 EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQ 300
Query: 463 FAAVPHPDVKPMAYANNFLRMF 484
F AVPHP+VKPMAYAN L++
Sbjct: 301 FTAVPHPNVKPMAYANTLLQLG 322
|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 | Back information, alignment and structure |
|---|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| d1s95a_ | 324 | Serine/threonine protein phosphatase 5, PP5 {Human | 100.0 | |
| d3c5wc1 | 288 | Protein phosphatase 2A catalytic subunit alpha iso | 100.0 | |
| d1jk7a_ | 294 | Protein phosphatase-1 (PP-1) {Human (Homo sapiens) | 100.0 | |
| d1auia_ | 473 | Protein phosphatase-2B (PP-2B, calcineurin A subun | 100.0 | |
| d1g5ba_ | 219 | lambda ser/thr protein phosphatase {Bacteriophage | 99.86 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.79 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.68 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.68 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.66 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.65 | |
| d1nnwa_ | 251 | Hypothetical protein PF1291 {Archaeon Pyrococcus f | 99.65 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.65 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.61 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.61 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.6 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.59 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.59 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.57 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.56 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.55 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.52 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.51 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.51 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.46 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.39 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.35 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.33 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.32 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.32 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.26 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.23 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.18 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.17 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.09 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.07 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.06 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.02 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d1uf3a_ | 228 | Hypothetical protein TT1561 {Thermus thermophilus | 99.02 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.0 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.99 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.97 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.94 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.89 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.78 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.77 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.76 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.66 | |
| d1s3la_ | 165 | Putative phosphodiesterase MJ0936 {Methanococcus j | 98.54 | |
| d3ck2a1 | 173 | Uncharacterized protein SP1879 {Streptococcus pneu | 98.5 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.46 | |
| d1su1a_ | 184 | Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 | 98.42 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.41 | |
| d2a22a1 | 193 | Vacuolar protein sorting 29, VPS29 {Cryptosporidiu | 98.39 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.31 | |
| d1z2wa1 | 182 | Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus | 98.31 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.28 | |
| d2yvta1 | 257 | Uncharacterized protein Aq_1956 {Aquifex aeolicus | 98.26 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.25 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.21 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.97 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.5 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.47 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.44 | |
| d1xm7a_ | 188 | Hypothetical protein aq_1666 {Aquifex aeolicus [Ta | 96.66 | |
| d3d03a1 | 271 | Glycerophosphodiesterase GpdQ {Enterobacter aeroge | 96.42 | |
| d1ii7a_ | 333 | Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.41 | |
| d2hy1a1 | 256 | Rv0805 cyclic nucleotide phosphodiesterase {Mycoba | 95.59 | |
| d2qfra2 | 312 | Plant purple acid phosphatase, catalytic domain {K | 93.72 | |
| d2nxfa1 | 320 | Uncharacterized C17orf48 homolog zgc:64213 {Zebraf | 92.88 | |
| d1utea_ | 302 | Mammalian purple acid phosphatase {Pig (Sus scrofa | 91.61 |
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Serine/threonine protein phosphatase 5, PP5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.3e-87 Score=642.44 Aligned_cols=319 Identities=60% Similarity=1.075 Sum_probs=304.9
Q ss_pred CCCccccCCcccHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHhhcCCCcceecCCCCCceeEecccCCCHHHHHHHHH
Q 011451 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFE 242 (485)
Q Consensus 163 ~~~~~l~~~~l~~~~l~~lie~l~~~~~l~~~~~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~dl~~il~ 242 (485)
|.+++++...++.+.++.+++.++..+.++.+++.++|.+++++|+++|+++++......+++||||+||++.||+++|+
T Consensus 1 ~~gp~~~~~~~t~~~~~~li~~~~~~~~l~~~~~~~ll~~~~~il~~e~~l~~i~~~~~~pv~VvGDiHGq~~DL~~if~ 80 (324)
T d1s95a_ 1 YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE 80 (324)
T ss_dssp CCSSCCBTTBCCHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCTTCEEEEECCCTTCHHHHHHHHH
T ss_pred CCCCcCCCCCcCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHhCCCeEEeecCCCCCEEEEEECCCCHHHHHHHHH
Confidence 45677776679999999999999999999999999999999999999999999986666689999999999999999999
Q ss_pred HcCCCCCCCCeEEcccccCCCCChHHHHHHHHhchhcCCCcEEEeccCCCccccccccCchhHHHhhhcHHHHHHHHHHh
Q 011451 243 LNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVF 322 (485)
Q Consensus 243 ~~~~~~~~~~~vflGD~vdrG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~~~~~~~~~~~f 322 (485)
..|+|+++.+|+|||||||||++|+||+.+|++||++||++|++||||||++.++..|||++||..+|+.++|..++++|
T Consensus 81 ~~g~p~~~~~ylFLGDYVDRG~~slEvi~lL~~lKi~yP~~v~LLRGNHE~~~~n~~ygF~~e~~~k~~~~l~~~~~~~F 160 (324)
T d1s95a_ 81 LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF 160 (324)
T ss_dssp HHCCCBTTBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHH
T ss_pred HCCCCCCCCeEEEecccccCcCcceeehHHHHHHHHhCCCcEEeccCCccccccccccccchHhhhhcCHHHHHHHHHHH
Confidence 99999987789999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccceeCCcEEEEeCccccCCCCChhhhhhccCCCCCCCCCcccccccCCCCCCCCCCcCCCCCccccCHHHHHHHH
Q 011451 323 CCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL 402 (485)
Q Consensus 323 ~~lPl~~~i~~~~~~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~fl 402 (485)
++||+||+|++++||||||||++...++++|++++|+.+++++++++|+|||||....++.+++||.|+.||++++++||
T Consensus 161 ~~LPlaa~I~~~ilcvHGGi~~~~~~~l~~i~~i~r~~~~~~~~~~~dlLWSDP~~~~~~~~~~Rg~g~~FG~~~~~~Fl 240 (324)
T d1s95a_ 161 EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL 240 (324)
T ss_dssp TTSCSEEEETTTEEECSSCCCSSSCCCHHHHHTCCCSSSCCSSSHHHHHHHCEECSSSSEEECTTSSSEEECHHHHHHHH
T ss_pred hhcchhhhccCcEEEecCCcCccccCCHHHHHhccCCCCCcchhhhhhhhccCccccCCcCcCCCCCcCCcCHHHHHHHH
Confidence 99999999999999999999777889999999999999999999999999999999889999999999999999999999
Q ss_pred HHCCCcEEEeeccccccCcEEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCCCCCCCccccchhh
Q 011451 403 QDNSLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFL 481 (485)
Q Consensus 403 ~~~~~~~iir~h~~~~~G~~~~~~~~~~tvfsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 481 (485)
++||+++||||||++++||++.+++||||||||||||+..+|.||+|.|++++++++|+||++.|+|.++||.||+.++
T Consensus 241 ~~n~l~lIIR~He~v~~G~~~~~~~kviTvFSa~nY~~~~~N~~a~l~i~~~~~~~~~~~f~~~p~p~~~p~~~~~~~~ 319 (324)
T d1s95a_ 241 EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLL 319 (324)
T ss_dssp HHHTCCEEEECCSCCTTSEEEEGGGTEEEECCCSSGGGTSCCCEEEEEEETTEEEEEEEEECCCCCCSCCTTTTSCHHH
T ss_pred HHcCCcEEEEcCccccCceEEecCCcEEEEeCCCccCCCCCcceEEEEEECCCceeEEEEecCCCCCCCChhhhhhHHH
Confidence 9999999999999999999999999999999999999999999999999666789999999999999999999997765
|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} | Back information, alignment and structure |
|---|
| >d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|