Citrus Sinensis ID: 011457

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MPGPAMDLEPVEPQSLKKLSLKSQKRALDLFSPTHGRLPPPDPESKKIRISHKLNLEYGGIKSTNEPRRQVNSTTIAHRNQPSGSSDVLALPGPEGSRDAQKAGAQNALVVGPSAQPKGLNNVGASGKSSAIVSTSASSERNLSTSAIMERIPSKWPRPEWHAPWKCYRVISGHLGWVRSVAFDHSNTWFCTGSADRTIKIWDVAKGTLKLTLTGHIEQVRGLAVSSKHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLGLHPTIDILLTGGRDSVCRVWDIRTKMQIFALAGHDNTVCSVFTRPTDPQVVTGSHDSTIKFWDLRYGKTMLTLTHHKKSVRAMALHPTEDCFASASAENIKKFNLPKGEFLHNMLSQQKTIINSMAVNEEGVLATGGDNGSLWFWDWKSGHNFQQAQTIVQPGSLDSEAGIYALSYDVTGSRLVTCEADKTIKMWREDETATPETHPLNFKPPKDIRRF
ccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEcccccEEEEEEccccEEEEccccccccccccccccccccEEEEEEcccccEEEECcccccEEEccccccccccCEEEEEEEccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEECcccEEEEEcccccEEEEcccccccEEEEEECccccEEEEEcccccEEEEEcccccEEEEEccccccccccccccEEEEEEcccccEEEEccccccEEEEEccccccccEEEEEEccccccccc
**********VEPQSLKKLSLKSQKRALDLFSPTHGRLPP**PESKKIRISHKLNLEYGGIKSTNEP***********************LPGPEG**DAQKAGAQNALVVGPSAQPKGLNNVGASGKSSAIVSTSASSERNLSTSAIMERIPSKWPRPEWHAPWKCYRVISGHLGWVRSVAFDHSNTWFCTGSADRTIKIWDVAKGTLKLTLTGHIEQVRGLAVSSKHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLGLHPTIDILLTGGRDSVCRVWDIRTKMQIFALAGHDNTVCSVFTRPTDPQVVTGSHDSTIKFWDLRYGKTMLTLTHHKKSVRAMALHPTEDCFASASAENIKKFNLPKGEFLHNMLSQQKTIINSMAVNEEGVLATGGDNGSLWFWDWKSGHNFQQAQTIVQPGSLDSEAGIYALSYDVTGSRLVTCEADKTIKMWREDETATPETHPLNFKPPKDIR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGPAMDLEPVEPQSLKKLSLKSQKRALDLFSPTHGRLPPPDPESKKIRISHKLNLEYGGIKSTNEPRRQVNSTTIAHRNQPSGSSDVLALPGPEGSRDAQKAGAQNALVVGPSAQPKGLNNVGASGKSSAIVSTSASSERNLSTSAIMERIPSKWPRPEWHAPWKCYRVISGHLGWVRSVAFDHSNTWFCTGSADRTIKIWDVAKGTLKLTLTGHIEQVRGLAVSSKHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLGLHPTIDILLTGGRDSVCRVWDIRTKMQIFALAGHDNTVCSVFTRPTDPQVVTGSHDSTIKFWDLRYGKTMLTLTHHKKSVRAMALHPTEDCFASASAENIKKFNLPKGEFLHNMLSQQKTIINSMAVNEEGVLATGGDNGSLWFWDWKSGHNFQQAQTIVQPGSLDSEAGIYALSYDVTGSRLVTCEADKTIKMWREDETATPETHPLNFKPPKDIRRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein pleiotropic regulatory locus 1 Pleiotropic regulator of glucose, stress and hormone responses. Also regulates cytochrome P450 CYP90A1/CPD. Coordinates the expression of hormone- and stress-related genes and genes related to cell wall modification and growth, leading to altered sugar-dependent growth and developmental responses. Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. By suppressing the expression of several (1)O(2)-responsive genes, PRL1 seems to play a major role in modulating responses of plants to environmental changes by interconnecting (1)O(2)-mediated retrograde signaling with other signaling pathways. Acts as negative regulator of SNF1-related protein kinases AKIN10 and AKIN11 via the inhibition of their interaction with SKP1/ASK1. Component of the CUL4-RBX1-DDB1-PRL1 E3 ubiquitin-protein ligase complex, PRL1 may function as the substrate recognition module within this complex, leading to the AKIN10 degradation.confidentQ42384
Pre-mRNA-splicing factor PRP46 Involved in pre-mRNA splicing and required for cell cycle progression at G2/M.probableQ6FJZ9
Pleiotropic regulator 1 Necessary for spliceosome assembly and for pre-mRNA splicing.probableQ9WUC8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P22, chain A
Confidence level:very confident
Coverage over the Query: 168-462
View the alignment between query and template
View the model in PyMOL
Template: 1P22, chain A
Confidence level:very confident
Coverage over the Query: 127-412
View the alignment between query and template
View the model in PyMOL