Citrus Sinensis ID: 011464

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY
ccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccccccccEEEEEEcHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccccEEEccccHHHccccccccccccHHHHHHHHHcEEEEccEEEEEccccccHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEccHHHHHccccEEEEcccccccccHHHHHcccccEEEEccccccccccHHHHccccccEEEEccccccEEEEcccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccc
ccccccccccccccEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEcccccHHHHHHHHHcccEEccEEccEEEEcccHHHHHHHHccHHHHHcHHHccccccccccccHHHHHHHHHHHHHHHHcccHcHHHHHHccEEEEccHHHHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHcccccEEEEEcccccEEEEcccccEEEEEHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHcccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccc
malsveksasgrefkvkdlsqadFGRLEIELAevempglmacraefgpsqpfkgakitgslHMTIQTAVLIETLTALGAEvrwcscnifsTQDHAAAAIARDSASVFAWKGETLQEYWWCTekaldwgpgggpdlivddggdatLLIHEGVKAEeiyektgklpdpastdnaEFQIVLTIIRDglkadpkkyHKMKERLVGVSEETTTGVKRLYQMqengtllfpainvndsvtkskfdnlygcrhslpdglmRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVltledvlsdADIFVTTTGNKDIIMVDHMKKMKNNAIVCnighfdneidmlgletypgvkritikpqtdrwvfpetnsgiiVLAEgrlmnlgcatghpsfvmscSFTNQVIAQLELWkekstgkyekkvyvlpkhLDEKVAALHLGKLGAKLTRLTKEQADyisvsadgpykplhyry
malsveksasgrefkvkdlsqadfGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKtgklpdpastdnAEFQIVLTIIRdglkadpkkyhkmkerlvgvseetttGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITikpqtdrwvfpeTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELwkekstgkyEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEqadyisvsadgpykplhyry
MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaaiardsasvfaWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVaalhlgklgaklTRLTKEQADYISVSADGPYKPLHYRY
**********************DFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEK***********NAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISV*************
**************KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKP***RY
***********REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY
**********GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPL*Y**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
Q01781485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.898 0.0
P35007485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.927 0.0
O23255485 Adenosylhomocysteinase 1 yes no 1.0 1.0 0.909 0.0
Q9SP37485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.915 0.0
P68173485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.919 0.0
P68172485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.919 0.0
P50246485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.911 0.0
Q9LK36485 Adenosylhomocysteinase 2 yes no 1.0 1.0 0.905 0.0
P93253485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.903 0.0
P32112485 Adenosylhomocysteinase OS N/A no 1.0 1.0 0.901 0.0
>sp|Q01781|SAHH_PETCR Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2 Back     alignment and function desciption
 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/485 (89%), Positives = 465/485 (95%)

Query: 1   MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS 60
           MALSVEK+A+GRE+KVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct: 1   MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS 60

Query: 61  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWC 120
           LHMTIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS +VFAWKGETLQEYWWC
Sbjct: 61  LHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWC 120

Query: 121 TEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 180
           TE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTDNAEFQIVL+I
Sbjct: 121 TERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSI 180

Query: 181 IRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN 240
           IRDGLK+DP KYHKMK+RLVGVSEETTTGVKRLYQMQ+NGTLLFPAINVNDSVTKSKFDN
Sbjct: 181 IRDGLKSDPMKYHKMKDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDN 240

Query: 241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300
           LYGCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQ
Sbjct: 241 LYGCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQ 300

Query: 301 ALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGL 360
           A MEGLQVL LEDV+S+ DIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDMLGL
Sbjct: 301 ATMEGLQVLPLEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGL 360

Query: 361 ETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420
           ETYPGVKRITIKPQTDRWVFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ
Sbjct: 361 ETYPGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420

Query: 421 LELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKP 480
           LELW EKS+GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+K+QADYISV  +GPYKP
Sbjct: 421 LELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKP 480

Query: 481 LHYRY 485
            HYRY
Sbjct: 481 AHYRY 485
Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
Petroselinum crispum (taxid: 4043)
EC: 3EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|P35007|SAHH_CATRO Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1 Back     alignment and function description
>sp|O23255|SAHH1_ARATH Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SP37|SAHH_LUPLU Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=1 SV=1 Back     alignment and function description
>sp|P68173|SAHH_TOBAC Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1 Back     alignment and function description
>sp|P68172|SAHH_NICSY Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1 Back     alignment and function description
>sp|P50246|SAHH_MEDSA Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1 Back     alignment and function description
>sp|Q9LK36|SAHH2_ARATH Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1 Back     alignment and function description
>sp|P93253|SAHH_MESCR Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1 Back     alignment and function description
>sp|P32112|SAHH_WHEAT Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
449442393485 PREDICTED: adenosylhomocysteinase-like [ 1.0 1.0 0.931 0.0
356525205485 PREDICTED: adenosylhomocysteinase-like [ 1.0 1.0 0.938 0.0
211905341485 S-adenosyl-L-homocystein hydrolase [Goss 1.0 1.0 0.938 0.0
255563606485 adenosylhomocysteinase, putative [Ricinu 1.0 1.0 0.931 0.0
356512439485 PREDICTED: adenosylhomocysteinase-like [ 1.0 1.0 0.940 0.0
29367605485 wheat adenosylhomocysteinase-like protei 1.0 1.0 0.931 0.0
336390551485 adenosylhomocysteinase [Glycine max] 1.0 1.0 0.934 0.0
429326634485 S-adenosyl-L-homocysteine hydrolase [Pop 1.0 1.0 0.927 0.0
312985249485 S-adenosyl-L-homocysteine hydrolase [Cuc 1.0 1.0 0.929 0.0
226491362485 adenosylhomocysteinase [Zea mays] gi|195 1.0 1.0 0.934 0.0
>gi|449442393|ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus] gi|449505280|ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/485 (93%), Positives = 474/485 (97%)

Query: 1   MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS 60
           M+L VEK+A+GRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct: 1   MSLIVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS 60

Query: 61  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWC 120
           LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA+VFAWKGETLQEYWWC
Sbjct: 61  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWC 120

Query: 121 TEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 180
           TE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTG LPDPASTDNAEFQIVLTI
Sbjct: 121 TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTI 180

Query: 181 IRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN 240
           IRDGLK+DPK+YHKMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDN
Sbjct: 181 IRDGLKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDN 240

Query: 241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300
           LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ
Sbjct: 241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300

Query: 301 ALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGL 360
           ALMEGLQVLTLED +S+ADIFVTTTGNKDIIMVDHM+KMKNNAIVCNIGHFDNEIDMLGL
Sbjct: 301 ALMEGLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGL 360

Query: 361 ETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420
           E YPGVKRITIKPQTDRWVFPETN GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ
Sbjct: 361 ENYPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420

Query: 421 LELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKP 480
           LELW E+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+K+QADYI+V  +GPYKP
Sbjct: 421 LELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKP 480

Query: 481 LHYRY 485
            HYRY
Sbjct: 481 AHYRY 485

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525205|ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max] Back     alignment and taxonomy information
>gi|211905341|gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255563606|ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis] gi|223538043|gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512439|ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max] Back     alignment and taxonomy information
>gi|29367605|gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica Group] gi|125534270|gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group] gi|222615923|gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|336390551|gb|AEI54335.1| adenosylhomocysteinase [Glycine max] Back     alignment and taxonomy information
>gi|429326634|gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa] Back     alignment and taxonomy information
>gi|312985249|gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus] Back     alignment and taxonomy information
>gi|226491362|ref|NP_001148534.1| adenosylhomocysteinase [Zea mays] gi|195620086|gb|ACG31873.1| adenosylhomocysteinase [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
TAIR|locus:2129256485 HOG1 "HOMOLOGY-DEPENDENT GENE 1.0 1.0 0.861 5.7e-233
TAIR|locus:2095193485 SAHH2 "S-adenosyl-l-homocystei 1.0 1.0 0.855 1.6e-230
UNIPROTKB|P60176495 ahcY "Adenosylhomocysteinase" 0.967 0.947 0.584 3.1e-147
TIGR_CMR|GSU_1875475 GSU_1875 "adenosylhomocysteina 0.975 0.995 0.562 2.2e-137
TIGR_CMR|SPO_3861462 SPO_3861 "adenosylhomocysteina 0.946 0.993 0.575 1.2e-136
TIGR_CMR|CBU_2031438 CBU_2031 "adenosylhomocysteina 0.597 0.662 0.625 4.7e-133
ZFIN|ZDB-GENE-031219-6433 ahcy "S-adenosylhomocysteine h 0.602 0.674 0.614 4.8e-131
UNIPROTKB|G4N4R7449 MGG_05155 "Adenosylhomocystein 0.602 0.650 0.610 1.4e-129
UNIPROTKB|F1P3F1438 AHCY "Adenosylhomocysteinase" 0.6 0.664 0.603 6.2e-129
ASPGD|ASPL0000057622449 AN1263 [Emericella nidulans (t 0.602 0.650 0.587 6.2e-129
TAIR|locus:2129256 HOG1 "HOMOLOGY-DEPENDENT GENE SILENCING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2247 (796.0 bits), Expect = 5.7e-233, P = 5.7e-233
 Identities = 418/485 (86%), Positives = 448/485 (92%)

Query:     1 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS 60
             MAL VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct:     1 MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS 60

Query:    61 LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWC 120
             LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC
Sbjct:    61 LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWC 120

Query:   121 TEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 180
             TE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STDN EFQIVL+I
Sbjct:   121 TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSI 180

Query:   181 IRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN 240
             I++GL+ DPKKYHKMKERLVGVSEETTTGVKRLYQMQ+NGTLLFPAINVNDSVTKSKFDN
Sbjct:   181 IKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDN 240

Query:   241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300
             LYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQ
Sbjct:   241 LYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQ 300

Query:   301 ALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGL 360
             ALMEGLQVLTLEDV+S+ADIFVTTTGNKDIIMVDHM+KMKNNAIVCNIGHFDNEIDMLGL
Sbjct:   301 ALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGL 360

Query:   361 ETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420
             ETYPGVKRITIKPQTDRWVFPET +GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ
Sbjct:   361 ETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420

Query:   421 LELWKEKSTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXTRLTKEQADYISVSADGPYKP 480
             LELW EK++GKYEKKVYVLPKHLDEKV            T+L+K+Q+DY+S+  +GPYKP
Sbjct:   421 LELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKP 480

Query:   481 LHYRY 485
              HYRY
Sbjct:   481 PHYRY 485
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004013 "adenosylhomocysteinase activity" evidence=IEA;ISS;IMP
GO:0005737 "cytoplasm" evidence=ISM
GO:0006730 "one-carbon metabolic process" evidence=IEA;ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
GO:0005773 "vacuole" evidence=IDA
GO:0006346 "methylation-dependent chromatin silencing" evidence=IMP
GO:0005507 "copper ion binding" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0051049 "regulation of transport" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0016441 "posttranscriptional gene silencing" evidence=IMP
TAIR|locus:2095193 SAHH2 "S-adenosyl-l-homocysteine (SAH) hydrolase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P60176 ahcY "Adenosylhomocysteinase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1875 GSU_1875 "adenosylhomocysteinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3861 SPO_3861 "adenosylhomocysteinase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2031 CBU_2031 "adenosylhomocysteinase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031219-6 ahcy "S-adenosylhomocysteine hydrolase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G4N4R7 MGG_05155 "Adenosylhomocysteinase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3F1 AHCY "Adenosylhomocysteinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000057622 AN1263 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q89HP6SAHH_BRAJA3, ., 3, ., 1, ., 10.63500.95670.9809yesno
B2HEP6SAHH_MYCMM3, ., 3, ., 1, ., 10.60650.97110.9573yesno
P35007SAHH_CATRO3, ., 3, ., 1, ., 10.92781.01.0N/Ano
A1UCK8SAHH_MYCSK3, ., 3, ., 1, ., 10.60560.97520.9672yesno
B0U232SAHH_XYLFM3, ., 3, ., 1, ., 10.60860.97110.9812yesno
Q9ABH0SAHH_CAUCR3, ., 3, ., 1, ., 10.65120.94430.9892yesno
B4SD43SAHH_PELPB3, ., 3, ., 1, ., 10.64270.95460.9830yesno
Q1BCD6SAHH_MYCSS3, ., 3, ., 1, ., 10.60560.97520.9672yesno
B8DR41SAHH_DESVM3, ., 3, ., 1, ., 10.63980.95250.9645yesno
A4ZHR8SAHH_MYCS23, ., 3, ., 1, ., 10.61230.96280.9628yesno
Q8KEG8SAHH_CHLTE3, ., 3, ., 1, ., 10.64360.94630.9745yesno
A3PW97SAHH_MYCSJ3, ., 3, ., 1, ., 10.60770.97520.9672yesno
A4SF77SAHH_PROVI3, ., 3, ., 1, ., 10.62370.95870.9872yesno
O23255SAHH1_ARATH3, ., 3, ., 1, ., 10.90921.01.0yesno
P60176SAHH_MYCTU3, ., 3, ., 1, ., 10.60900.96700.9474yesno
P32112SAHH_WHEAT3, ., 3, ., 1, ., 10.90101.01.0N/Ano
B3QMF5SAHH_CHLP83, ., 3, ., 1, ., 10.65190.94630.9745yesno
Q7TWW7SAHH_MYCBO3, ., 3, ., 1, ., 10.61110.96700.9474yesno
P93253SAHH_MESCR3, ., 3, ., 1, ., 10.90301.01.0N/Ano
C1AH22SAHH_MYCBT3, ., 3, ., 1, ., 10.60900.96700.9474yesno
A1KNQ0SAHH_MYCBP3, ., 3, ., 1, ., 10.60900.96700.9474yesno
P50249SAHH_PHASS3, ., 3, ., 1, ., 10.90511.01.0N/Ano
P68172SAHH_NICSY3, ., 3, ., 1, ., 10.91951.01.0N/Ano
P50246SAHH_MEDSA3, ., 3, ., 1, ., 10.91131.01.0N/Ano
Q936D6SAHH_STRAA3, ., 3, ., 1, ., 10.62780.96900.9751N/Ano
P68173SAHH_TOBAC3, ., 3, ., 1, ., 10.91951.01.0N/Ano
Q8GGL7SAHH_STRAZ3, ., 3, ., 1, ., 10.64650.95870.9914N/Ano
Q3B532SAHH_PELLD3, ., 3, ., 1, ., 10.62680.96280.9915yesno
Q9CCJ4SAHH_MYCLE3, ., 3, ., 1, ., 10.60690.96700.9532yesno
Q9KZM1SAHH_STRCO3, ., 3, ., 1, ., 10.63710.96280.9628yesno
Q64MT2SAHH_BACFR3, ., 3, ., 1, ., 10.65960.94430.9404yesno
Q8A407SAHH_BACTN3, ., 3, ., 1, ., 10.65960.94430.9621yesno
Q7RKK8SAHH_PLAYO3, ., 3, ., 1, ., 10.60750.96900.9812N/Ano
Q01781SAHH_PETCR3, ., 3, ., 1, ., 10.89891.01.0N/Ano
A0PRF5SAHH_MYCUA3, ., 3, ., 1, ., 10.60860.97110.9573yesno
A5U7S2SAHH_MYCTA3, ., 3, ., 1, ., 10.60900.96700.9474yesno
B3EDY3SAHH_CHLL23, ., 3, ., 1, ., 10.64360.96280.9915yesno
Q82DC9SAHH_STRAW3, ., 3, ., 1, ., 10.63290.96280.9628yesno
B1VUW6SAHH_STRGG3, ., 3, ., 1, ., 10.64120.96280.9628yesno
Q3AQC2SAHH_CHLCH3, ., 3, ., 1, ., 10.64570.96280.9915yesno
P51540SAHH_TRIVA3, ., 3, ., 1, ., 10.60400.97310.9711N/Ano
Q9SWF5SAHH_SOLLC3, ., 3, ., 1, ., 10.88451.01.0N/Ano
Q9SP37SAHH_LUPLU3, ., 3, ., 1, ., 10.91541.01.0N/Ano
Q4XZZ5SAHH_PLACH3, ., 3, ., 1, ., 10.60540.96900.9812N/Ano
Q30WL8SAHH_DESDG3, ., 3, ., 1, ., 10.65690.94840.9603yesno
Q73UK6SAHH_MYCPA3, ., 3, ., 1, ., 10.60610.96700.9455N/Ano
Q5YQS7SAHH_NOCFA3, ., 3, ., 1, ., 10.61030.96490.9473yesno
Q9LK36SAHH2_ARATH3, ., 3, ., 1, ., 10.90511.01.0yesno
B8ZQE9SAHH_MYCLB3, ., 3, ., 1, ., 10.60690.96700.9532yesno
P50250SAHH_PLAF73, ., 3, ., 1, ., 10.59490.96900.9812yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.3.10.998
3rd Layer3.3.1.10.993

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb05g014470.1
annotation not avaliable (486 aa)
(Sorghum bicolor)
Predicted Functional Partners:
Sb03g013170.1
annotation not avaliable (394 aa)
•  •  • 0.954
Sb03g011930.1
hypothetical protein; Catalyzes the formation of S-adenosylmethionine from methionine and ATP ( [...] (397 aa)
•  •  • 0.953
Sb09g002840.1
hypothetical protein; Catalyzes the formation of S-adenosylmethionine from methionine and ATP ( [...] (397 aa)
•  •  • 0.953
Sb03g009210.1
annotation not avaliable (202 aa)
   •  • 0.905
Sb09g003950.1
hypothetical protein (594 aa)
   •  • 0.864
Sb01g003700.1
hypothetical protein (593 aa)
•  •  • 0.835
Sb04g029070.1
hypothetical protein (803 aa)
•  •  • 0.828
Sb01g042830.1
hypothetical protein (800 aa)
•  •  • 0.824
Sb05g008680.1
annotation not avaliable (367 aa)
•  •  • 0.818
Sb08g003330.1
hypothetical protein (490 aa)
•     • 0.810

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 0.0
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 0.0
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 0.0
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 0.0
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 0.0
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 0.0
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 0.0
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 0.0
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 1e-109
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 3e-97
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 6e-45
pfam02254116 pfam02254, TrkA_N, TrkA-N domain 1e-08
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 6e-08
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 7e-07
cd12172306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 4e-06
cd12175311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 5e-06
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 1e-05
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 1e-05
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 3e-05
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 6e-05
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 7e-05
cd12177321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 7e-05
cd12186329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 1e-04
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 2e-04
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 3e-04
cd12173304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 8e-04
cd12174305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 8e-04
cd12161315 cd12161, GDH_like_1, Putative glycerate dehydrogen 0.001
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 0.001
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 0.001
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 0.001
pfam13241104 pfam13241, NAD_binding_7, Putative NAD(P)-binding 0.003
cd01080168 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding 0.003
PRK14192283 PRK14192, PRK14192, bifunctional 5,10-methylene-te 0.004
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information 
 Score = 1042 bits (2696), Expect = 0.0
 Identities = 441/477 (92%), Positives = 463/477 (97%)

Query: 9   ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTA 68
           +SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTA
Sbjct: 1   SSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTA 60

Query: 69  VLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWG 128
           VLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA+VFAWKGETLQEYWWCTE+ALDWG
Sbjct: 61  VLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWG 120

Query: 129 PGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 188
           PGGGPDLIVDDGGDATLLIHEGVKAEE +EK G LPDP STDNAEF+IVLTII+DGLK D
Sbjct: 121 PGGGPDLIVDDGGDATLLIHEGVKAEEEFEKDGTLPDPTSTDNAEFKIVLTIIKDGLKVD 180

Query: 189 PKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSL 248
           PKKYHKMKERLVGVSEETTTGVKRLYQMQ+NGTLLFPAINVNDSVTKSKFDNLYGCRHSL
Sbjct: 181 PKKYHKMKERLVGVSEETTTGVKRLYQMQKNGTLLFPAINVNDSVTKSKFDNLYGCRHSL 240

Query: 249 PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 308
           PDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALMEG QV
Sbjct: 241 PDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKAAGARVIVTEIDPICALQALMEGYQV 300

Query: 309 LTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKR 368
           LTLEDV+S+ADIFVTTTGNKDIIMVDHM+KMKNNAIVCNIGHFDNEIDMLGLETYPGVKR
Sbjct: 301 LTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKR 360

Query: 369 ITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKS 428
           ITIKPQTDRWVFP+T SGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK 
Sbjct: 361 ITIKPQTDRWVFPDTGSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKK 420

Query: 429 TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY 485
           +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+K+QADYI+V  +GPYKP HYRY
Sbjct: 421 SGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY 477

Length = 477
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|222002 pfam13241, NAD_binding_7, Putative NAD(P)-binding Back     alignment and domain information
>gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 100.0
PLN02494477 adenosylhomocysteinase 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 100.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 100.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 99.96
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.81
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.73
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.72
COG0300265 DltE Short-chain dehydrogenases of various substra 99.71
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.7
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.7
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.69
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.67
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.63
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.63
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.63
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.62
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.62
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
PRK08339263 short chain dehydrogenase; Provisional 99.6
PRK06487317 glycerate dehydrogenase; Provisional 99.58
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.58
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.58
PLN02306386 hydroxypyruvate reductase 99.58
KOG0725270 consensus Reductases with broad range of substrate 99.58
PLN02928347 oxidoreductase family protein 99.57
PLN03139386 formate dehydrogenase; Provisional 99.57
PRK13243333 glyoxylate reductase; Reviewed 99.56
PRK08862227 short chain dehydrogenase; Provisional 99.56
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.56
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 99.56
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
PRK06932314 glycerate dehydrogenase; Provisional 99.56
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.55
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK07574385 formate dehydrogenase; Provisional 99.54
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.54
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.53
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.53
PRK05867253 short chain dehydrogenase; Provisional 99.52
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.52
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.52
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.51
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.51
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.51
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 99.5
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.5
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.5
PRK07791286 short chain dehydrogenase; Provisional 99.49
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.48
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.48
PRK08303305 short chain dehydrogenase; Provisional 99.48
PRK07063260 short chain dehydrogenase; Provisional 99.48
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.47
PRK07062265 short chain dehydrogenase; Provisional 99.47
PRK08589272 short chain dehydrogenase; Validated 99.46
PRK05872296 short chain dehydrogenase; Provisional 99.46
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.46
PRK06139330 short chain dehydrogenase; Provisional 99.46
PRK06436303 glycerate dehydrogenase; Provisional 99.44
PRK05876275 short chain dehydrogenase; Provisional 99.44
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.44
PRK08265261 short chain dehydrogenase; Provisional 99.43
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.43
PRK08277278 D-mannonate oxidoreductase; Provisional 99.43
PRK07478254 short chain dehydrogenase; Provisional 99.43
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.42
PRK06398258 aldose dehydrogenase; Validated 99.42
PRK12747252 short chain dehydrogenase; Provisional 99.42
PRK06114254 short chain dehydrogenase; Provisional 99.41
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.41
PRK06484520 short chain dehydrogenase; Validated 99.4
PRK05854313 short chain dehydrogenase; Provisional 99.4
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.4
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.4
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.4
PRK05993277 short chain dehydrogenase; Provisional 99.39
PRK07825273 short chain dehydrogenase; Provisional 99.39
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.38
PRK06182273 short chain dehydrogenase; Validated 99.38
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.38
PRK12480330 D-lactate dehydrogenase; Provisional 99.37
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.36
PRK07985294 oxidoreductase; Provisional 99.36
PRK06940275 short chain dehydrogenase; Provisional 99.36
PRK05599246 hypothetical protein; Provisional 99.36
PRK08340259 glucose-1-dehydrogenase; Provisional 99.36
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.36
PRK06128300 oxidoreductase; Provisional 99.35
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.35
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.33
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.33
PRK07831262 short chain dehydrogenase; Provisional 99.33
PLN02780320 ketoreductase/ oxidoreductase 99.33
PLN02253280 xanthoxin dehydrogenase 99.32
PRK05855582 short chain dehydrogenase; Validated 99.32
PRK06172253 short chain dehydrogenase; Provisional 99.32
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.32
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.31
PRK07677252 short chain dehydrogenase; Provisional 99.31
PRK09242257 tropinone reductase; Provisional 99.31
PRK06125259 short chain dehydrogenase; Provisional 99.31
PRK08605332 D-lactate dehydrogenase; Validated 99.3
PRK07109 334 short chain dehydrogenase; Provisional 99.3
PRK06523260 short chain dehydrogenase; Provisional 99.3
PRK07035252 short chain dehydrogenase; Provisional 99.3
PRK06180277 short chain dehydrogenase; Provisional 99.29
PRK05866293 short chain dehydrogenase; Provisional 99.29
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.29
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.28
PRK05884223 short chain dehydrogenase; Provisional 99.28
PRK06484 520 short chain dehydrogenase; Validated 99.28
PRK05717255 oxidoreductase; Validated 99.28
PRK06483236 dihydromonapterin reductase; Provisional 99.28
PRK05693274 short chain dehydrogenase; Provisional 99.28
PRK07576264 short chain dehydrogenase; Provisional 99.28
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.28
PRK06196315 oxidoreductase; Provisional 99.28
PRK07856252 short chain dehydrogenase; Provisional 99.27
PRK08643256 acetoin reductase; Validated 99.27
PRK06179270 short chain dehydrogenase; Provisional 99.27
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.27
PRK07024257 short chain dehydrogenase; Provisional 99.27
PRK06194287 hypothetical protein; Provisional 99.26
COG1028251 FabG Dehydrogenases with different specificities ( 99.26
PRK06841255 short chain dehydrogenase; Provisional 99.26
PRK07067257 sorbitol dehydrogenase; Provisional 99.25
PRK08936261 glucose-1-dehydrogenase; Provisional 99.25
PRK08628258 short chain dehydrogenase; Provisional 99.25
PRK08278273 short chain dehydrogenase; Provisional 99.25
PRK07814263 short chain dehydrogenase; Provisional 99.23
PRK07890258 short chain dehydrogenase; Provisional 99.23
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.22
PRK06197306 short chain dehydrogenase; Provisional 99.22
PRK05650270 short chain dehydrogenase; Provisional 99.22
PRK08263275 short chain dehydrogenase; Provisional 99.22
PRK09072263 short chain dehydrogenase; Provisional 99.21
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.21
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.21
KOG1208314 consensus Dehydrogenases with different specificit 99.2
PRK09186256 flagellin modification protein A; Provisional 99.2
PRK06701290 short chain dehydrogenase; Provisional 99.2
PRK12744257 short chain dehydrogenase; Provisional 99.2
PRK12742237 oxidoreductase; Provisional 99.19
PRK12743256 oxidoreductase; Provisional 99.19
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.19
PRK06500249 short chain dehydrogenase; Provisional 99.19
PRK08226263 short chain dehydrogenase; Provisional 99.18
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.17
PRK07832272 short chain dehydrogenase; Provisional 99.17
PRK06101240 short chain dehydrogenase; Provisional 99.17
PRK07904253 short chain dehydrogenase; Provisional 99.17
PRK12937245 short chain dehydrogenase; Provisional 99.17
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.16
PRK06057255 short chain dehydrogenase; Provisional 99.15
PRK07454241 short chain dehydrogenase; Provisional 99.15
PRK08267260 short chain dehydrogenase; Provisional 99.15
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.14
PRK06949258 short chain dehydrogenase; Provisional 99.14
PRK07201657 short chain dehydrogenase; Provisional 99.14
PRK06914280 short chain dehydrogenase; Provisional 99.13
PRK06138252 short chain dehydrogenase; Provisional 99.13
PRK12939250 short chain dehydrogenase; Provisional 99.13
PRK06482276 short chain dehydrogenase; Provisional 99.12
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.12
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.12
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.12
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.12
PRK08703239 short chain dehydrogenase; Provisional 99.11
PRK07578199 short chain dehydrogenase; Provisional 99.11
PRK08251248 short chain dehydrogenase; Provisional 99.11
PLN00015308 protochlorophyllide reductase 99.11
PRK07774250 short chain dehydrogenase; Provisional 99.1
PRK10538248 malonic semialdehyde reductase; Provisional 99.1
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
PRK08177225 short chain dehydrogenase; Provisional 99.09
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.08
PRK06198260 short chain dehydrogenase; Provisional 99.08
PRK05875276 short chain dehydrogenase; Provisional 99.07
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.07
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.06
PRK07577234 short chain dehydrogenase; Provisional 99.06
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.06
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.06
PRK12367245 short chain dehydrogenase; Provisional 99.05
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.05
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.04
PRK08324681 short chain dehydrogenase; Validated 99.04
PRK07775274 short chain dehydrogenase; Provisional 99.04
PRK07806248 short chain dehydrogenase; Provisional 99.03
PRK09291257 short chain dehydrogenase; Provisional 99.02
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.02
PRK07326237 short chain dehydrogenase; Provisional 99.02
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.01
PRK12828239 short chain dehydrogenase; Provisional 99.01
PRK12746254 short chain dehydrogenase; Provisional 99.01
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.99
PRK07069251 short chain dehydrogenase; Validated 98.98
PRK06924251 short chain dehydrogenase; Provisional 98.98
PRK07074257 short chain dehydrogenase; Provisional 98.98
PRK09134258 short chain dehydrogenase; Provisional 98.98
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 98.97
PRK07060245 short chain dehydrogenase; Provisional 98.97
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.97
PRK06181263 short chain dehydrogenase; Provisional 98.97
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.96
PRK08017256 oxidoreductase; Provisional 98.96
PRK07102243 short chain dehydrogenase; Provisional 98.95
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.95
PRK06123248 short chain dehydrogenase; Provisional 98.94
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.94
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.93
KOG0067435 consensus Transcription factor CtBP [Transcription 98.93
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.9
PRK08264238 short chain dehydrogenase; Validated 98.87
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.87
PRK07023243 short chain dehydrogenase; Provisional 98.86
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.86
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.86
PRK06947248 glucose-1-dehydrogenase; Provisional 98.86
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.85
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.84
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.82
PRK12829264 short chain dehydrogenase; Provisional 98.82
PRK07041230 short chain dehydrogenase; Provisional 98.79
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.77
PRK12827249 short chain dehydrogenase; Provisional 98.77
PRK06953222 short chain dehydrogenase; Provisional 98.74
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.74
PRK09135249 pteridine reductase; Provisional 98.71
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 98.7
PRK09009235 C factor cell-cell signaling protein; Provisional 98.69
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.64
PRK13403335 ketol-acid reductoisomerase; Provisional 98.63
COG0623259 FabI Enoyl-[acyl-carrier-protein] 98.54
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.49
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.48
PRK06720169 hypothetical protein; Provisional 98.43
PRK08219227 short chain dehydrogenase; Provisional 98.41
KOG1611249 consensus Predicted short chain-type dehydrogenase 98.39
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.38
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.38
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.29
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 98.22
PLN03209 576 translocon at the inner envelope of chloroplast su 98.22
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.21
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.2
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.19
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.18
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.16
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.13
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.07
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 98.05
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.02
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 98.0
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 97.99
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.96
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.94
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.93
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.91
PRK05479330 ketol-acid reductoisomerase; Provisional 97.91
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.9
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.9
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.9
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.89
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.89
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.89
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.87
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.87
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.87
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.86
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 97.86
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.85
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.83
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.83
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.82
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.82
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.82
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.81
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.8
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.79
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.79
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.78
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.78
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.77
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.76
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.75
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.73
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.72
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.68
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.68
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.68
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 97.68
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.67
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.67
PLN02653 340 GDP-mannose 4,6-dehydratase 97.66
PLN00203519 glutamyl-tRNA reductase 97.66
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.66
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.64
PRK05225 487 ketol-acid reductoisomerase; Validated 97.64
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.63
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.62
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.61
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.58
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 97.58
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.58
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.56
PRK13940414 glutamyl-tRNA reductase; Provisional 97.54
PRK14982340 acyl-ACP reductase; Provisional 97.51
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 97.5
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.44
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.38
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.36
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.33
PLN02712667 arogenate dehydrogenase 97.33
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.31
PLN02240 352 UDP-glucose 4-epimerase 97.31
PRK07417279 arogenate dehydrogenase; Reviewed 97.23
PLN00198 338 anthocyanidin reductase; Provisional 97.22
PLN02896 353 cinnamyl-alcohol dehydrogenase 97.21
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.2
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.19
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.13
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 97.12
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.1
PLN02572 442 UDP-sulfoquinovose synthase 97.05
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.04
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.04
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.03
PLN02583297 cinnamoyl-CoA reductase 96.99
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.99
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 96.99
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.98
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 96.98
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.95
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.92
PLN02650 351 dihydroflavonol-4-reductase 96.92
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 96.87
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 96.86
PRK08507275 prephenate dehydrogenase; Validated 96.85
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 96.85
PLN02256304 arogenate dehydrogenase 96.81
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.8
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.79
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.79
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.78
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 96.78
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.75
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.75
KOG0409327 consensus Predicted dehydrogenase [General functio 96.75
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.72
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.71
PLN02342348 ornithine carbamoyltransferase 96.71
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.71
PLN02214 342 cinnamoyl-CoA reductase 96.7
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.68
PLN02688266 pyrroline-5-carboxylate reductase 96.67
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.66
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 96.65
PRK01713334 ornithine carbamoyltransferase; Provisional 96.65
PRK15059292 tartronate semialdehyde reductase; Provisional 96.64
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.63
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 96.63
PRK06545 359 prephenate dehydrogenase; Validated 96.59
PLN02858 1378 fructose-bisphosphate aldolase 96.58
PRK08618325 ornithine cyclodeaminase; Validated 96.58
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.57
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.56
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.56
PLN02712 667 arogenate dehydrogenase 96.54
PRK10675 338 UDP-galactose-4-epimerase; Provisional 96.53
PRK07340304 ornithine cyclodeaminase; Validated 96.51
PRK04284332 ornithine carbamoyltransferase; Provisional 96.5
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.5
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.49
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 96.49
PRK08655 437 prephenate dehydrogenase; Provisional 96.48
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.47
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.44
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.43
PRK12862 763 malic enzyme; Reviewed 96.42
PRK02102331 ornithine carbamoyltransferase; Validated 96.41
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.4
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.39
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.38
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.38
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 96.37
PRK00779304 ornithine carbamoyltransferase; Provisional 96.37
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 96.36
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.34
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.34
PLN02858 1378 fructose-bisphosphate aldolase 96.31
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.3
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 96.3
PLN02477410 glutamate dehydrogenase 96.28
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.28
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.27
PRK14805302 ornithine carbamoyltransferase; Provisional 96.23
PRK07680273 late competence protein ComER; Validated 96.22
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.22
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.21
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 96.2
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.19
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.17
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 96.17
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 96.16
PRK02255338 putrescine carbamoyltransferase; Provisional 96.16
PRK06141314 ornithine cyclodeaminase; Validated 96.14
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 96.14
PRK08309177 short chain dehydrogenase; Provisional 96.14
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.11
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 96.09
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.09
PLN02527306 aspartate carbamoyltransferase 96.08
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 96.08
PLN02740381 Alcohol dehydrogenase-like 96.08
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.06
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.05
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.03
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.03
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.02
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.01
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.99
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.98
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.96
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 95.95
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 95.95
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 95.95
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 95.94
PLN02586360 probable cinnamyl alcohol dehydrogenase 95.94
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.94
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.93
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.93
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 95.93
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 95.91
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.91
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 95.9
PRK09414445 glutamate dehydrogenase; Provisional 95.9
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.89
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 95.88
PRK14031444 glutamate dehydrogenase; Provisional 95.85
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 95.85
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 95.82
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.81
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 95.79
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 95.78
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.78
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 95.77
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 95.77
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 95.75
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.75
PLN02178375 cinnamyl-alcohol dehydrogenase 95.73
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 95.71
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 95.68
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.68
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 95.67
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.66
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.63
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.58
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.57
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 95.55
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 95.55
PRK06719157 precorrin-2 dehydrogenase; Validated 95.52
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 95.41
PRK12861 764 malic enzyme; Reviewed 95.4
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 95.39
PLN02827378 Alcohol dehydrogenase-like 95.38
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.32
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 95.3
PRK14030445 glutamate dehydrogenase; Provisional 95.26
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 95.25
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 95.22
PRK08291330 ectoine utilization protein EutC; Validated 95.1
PRK08818 370 prephenate dehydrogenase; Provisional 95.08
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 95.06
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 95.04
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.03
PRK06046326 alanine dehydrogenase; Validated 94.99
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.97
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 94.96
PRK14804311 ornithine carbamoyltransferase; Provisional 94.96
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 94.94
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 94.94
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 94.92
PRK04148134 hypothetical protein; Provisional 94.91
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 94.9
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.8
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 94.8
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 94.78
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-114  Score=848.76  Aligned_cols=418  Identities=57%  Similarity=0.881  Sum_probs=405.9

Q ss_pred             CCcceecCCCchhhhhhhHHHHHhhCchHHHHHHHhCCCCCCCCceEEeeecccHhHHHHHHHHHhCCCEEEEEeCCCCC
Q 011464           11 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFS   90 (485)
Q Consensus        11 ~~~~~~~d~~~~~~g~~~~~~~~~~mp~l~~~~~~~~~~~pl~G~~i~~~lh~~~~t~~l~~~L~~~gA~v~~~~~~~~s   90 (485)
                      .++|+|||||||++|+++|+||++|||+|+++|++|..+|||||.||++|||||.||++|++||+++||||+|++|||||
T Consensus         2 ~~~y~v~Disla~~Gr~~i~wAe~~MP~L~~iR~~f~~~kPlkG~~i~~~lH~t~kTAvLietL~a~GAeV~~a~cNplS   81 (420)
T COG0499           2 GQDYKVKDISLADEGRKEIEWAEREMPVLMAIREEFAEEKPLKGARIAGCLHMTAKTAVLIETLKAGGAEVRWASCNPLS   81 (420)
T ss_pred             CccceecchhhhhhhhHHHHHHHhhChHHHHHHHHHhhcCCCCccEEEEEEeehHHHHHHHHHHHhcCceEEEecCCCCc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHhC-CCeEEEecCCCHHHHHHHHHHHHhcCCCCCCceEecCCCceeeeeecchhhhhhhhhcCCCCCCCCC
Q 011464           91 TQDHAAAAIARD-SASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST  169 (485)
Q Consensus        91 t~d~~a~al~~~-g~~v~a~~~~~~~~~~~~~~~~~~~~~~~~p~~~~ddgg~l~~~~~~~~~~~~~~~~~~~~~~~~~~  169 (485)
                      ||||||+||+.. |+||||||||+.+||||+++++|+|+    |++++|||||++.++|                     
T Consensus        82 TqD~vaaAl~~~~GipVfA~kGe~~eeY~~~~~~vl~~~----p~iiiDDG~D~~~~vh---------------------  136 (420)
T COG0499          82 TQDDVAAALAAKEGIPVFAWKGETLEEYYEAIDQVLDWE----PNIIIDDGGDLTKLVH---------------------  136 (420)
T ss_pred             ccHHHHHHHhhccCceEEEEcCCCHHHHHHHHHHHhCcC----CCEEEecCcceeeeee---------------------
Confidence            999999999665 99999999999999999999999985    9999999999999999                     


Q ss_pred             chhHHHHHHHHHHhhccCCchhhhhhhhhhhcceeeccchhhhHHHHHHcCCceeecccccchhhhhHHhhhhhccccch
Q 011464          170 DNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLP  249 (485)
Q Consensus       170 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~E~t~tGv~~l~~~~~~g~l~~pv~~v~~sv~e~~~~~~~~~~~~~~  249 (485)
                                          ..++.+++.++|++|||||||+||++|.+.|.+.||++|||||++|++|||.|||++|++
T Consensus       137 --------------------~~~~~l~~~i~G~tEETTTGV~RL~am~~~G~L~fPai~VNDs~tK~~FDNrYGtgqS~~  196 (420)
T COG0499         137 --------------------LERPELLDAIKGGTEETTTGVHRLRAMEKDGVLKFPAINVNDSVTKSLFDNRYGTGQSLL  196 (420)
T ss_pred             --------------------cccHHHHHHhcCCCcccchHHHHHHHHHhcCCcccceEeecchhhhcccccccccchhHH
Confidence                                567888899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCccccCcEEEEECCChHHHHHHHHHHHCCCEEEEEeCChhHHHHHHHhCCcccCHHHHHHhHhHHhhhcCCcc
Q 011464          250 DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKD  329 (485)
Q Consensus       250 ~~~~~~~~~~l~Gk~vvV~G~GgIG~~iA~~l~~~Ga~Viv~dr~~~~~~~a~~~g~~v~~~~~~~~~~Div~~~~g~~~  329 (485)
                      ++++|+|++.+.||+++|.|||++||++|++++++||+|+|++.+|.++.+|.++||+++.++++...+|++++++|+.+
T Consensus       197 DgI~RaTn~liaGK~vVV~GYG~vGrG~A~~~rg~GA~ViVtEvDPI~AleA~MdGf~V~~m~~Aa~~gDifiT~TGnkd  276 (420)
T COG0499         197 DGILRATNVLLAGKNVVVAGYGWVGRGIAMRLRGMGARVIVTEVDPIRALEAAMDGFRVMTMEEAAKTGDIFVTATGNKD  276 (420)
T ss_pred             HHHHhhhceeecCceEEEecccccchHHHHHhhcCCCeEEEEecCchHHHHHhhcCcEEEEhHHhhhcCCEEEEccCCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeehhHHhcCCCCeEEEecCCCCCcccccCccccccceeeecccchhhccccCcccccccccCceEEEEcCCCCCCccch
Q 011464          330 IIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVM  409 (485)
Q Consensus       330 il~~~~l~~m~~~aiv~N~g~~~~e~~~~~le~~~~~~~vnl~~~v~~~~lp~g~~~i~ll~~GrIVNisS~~g~~~~~~  409 (485)
                      +++.++|..||+++++.|+|||+.|++...+++. .....|+++.+.+|.+|+|+ +++++++||+||++++.|||+++|
T Consensus       277 Vi~~eh~~~MkDgaIl~N~GHFd~EI~~~~L~~~-~~~~~~vr~~V~ey~l~~Gk-ri~llaeGRLvNLa~a~GHPs~VM  354 (420)
T COG0499         277 VIRKEHFEKMKDGAILANAGHFDVEIDVAGLEEL-AVEKREVRPQVDEYELPDGK-RIILLAEGRLVNLAAATGHPSEVM  354 (420)
T ss_pred             ccCHHHHHhccCCeEEecccccceeccHHHHHHh-hhhHhccccCceEEEcCCCC-EEEEEecceeeeeccCCCCcHHHh
Confidence            9999999999999999999999999998887755 33667999999999999999 999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHhhhcCCCCceEEeCchhHHHHHHHhhccccCceeeccChhhhhhccccCCCC
Q 011464          410 SCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGP  477 (485)
Q Consensus       410 ~~s~a~~al~~l~l~~~~~~~~~~~gV~~lp~~ld~~va~~~L~~~G~~~~~Lt~~q~~yl~~~~~g~  477 (485)
                      +.||++|++++++++.+..  ++.++||.+|+++|++||+++|+.+|++++.||++|++||++|.+||
T Consensus       355 d~SFanQaLa~~~L~~n~~--~~~~~Vy~lP~~lD~~VArl~L~~~G~~i~~Lt~eQ~~Yl~~w~~Gt  420 (420)
T COG0499         355 DMSFANQALAQIYLVKNHG--KLEPGVYRLPKELDEEVARLKLEAMGIELDELTEEQAEYLGSWEEGT  420 (420)
T ss_pred             hhhHHHHHHHHHHHHhccc--ccCCceeeCcHHHHHHHHHHHHHHhCceeeecCHHHHHHhCCCCCCC
Confidence            9999999999999999987  99999999999999999999999999999999999999999999997

>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 0.0
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 1e-163
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 1e-162
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 1e-162
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-150
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-147
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 1e-143
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 1e-141
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 1e-133
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 1e-132
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 1e-132
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 1e-132
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 1e-132
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 1e-125
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 1e-111
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 1e-110
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure 
Iteration: 1

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/485 (86%), Positives = 445/485 (91%)
Query: 1   MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS 60
           MAL VEK+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGS
Sbjct: 4   MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGS 63
Query: 61  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWC 120
           LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC
Sbjct: 64  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWC 123
Query: 121 TEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 180
           TE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+I
Sbjct: 124 TERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSI 183
Query: 181 IRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN 240
           I++GLK DPK+YHKMK+R+VGVSEETTTGVKRLYQMQ NGTLLFPAINVNDSVTKSKFDN
Sbjct: 184 IKEGLKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDN 243
Query: 241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300
           LYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQ
Sbjct: 244 LYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 303
Query: 301 ALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGL 360
           A MEGLQVLTLEDV+S+ADIFVTTTGNKDIIM+DHMKKMKNNAIVCNIGHFDNEIDMLGL
Sbjct: 304 ATMEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGL 363
Query: 361 ETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420
           ET+PGVKRITIKPQTDRWVFPETN+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ
Sbjct: 364 ETHPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 423
Query: 421 LELWKEKSTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXTRLTKEQADYISVSADGPYKP 480
           LELW EKS+GKYEKKVYVLPKHLDEKV            T+L+K+QADYISV  +GPYKP
Sbjct: 424 LELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKP 483
Query: 481 LHYRY 485
            HYRY
Sbjct: 484 FHYRY 488
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 0.0
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 0.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 0.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 0.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 0.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 0.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 0.0
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 7e-18
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 3e-07
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 2e-06
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 3e-06
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 3e-06
1id1_A153 Putative potassium channel protein; RCK domain, E. 4e-06
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 7e-06
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 7e-06
2rir_A300 Dipicolinate synthase, A chain; structural genomic 1e-05
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 1e-05
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 1e-05
3c85_A183 Putative glutathione-regulated potassium-efflux S 2e-05
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 2e-05
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 2e-05
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 3e-05
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 4e-05
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 4e-05
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 5e-05
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 5e-05
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 5e-05
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-05
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 6e-05
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 9e-05
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 1e-04
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 2e-04
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 2e-04
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 2e-04
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 2e-04
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 2e-04
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 3e-04
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 3e-04
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 4e-04
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 4e-04
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 4e-04
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 4e-04
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 4e-04
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 5e-04
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 5e-04
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 5e-04
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 6e-04
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 6e-04
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 6e-04
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 8e-04
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
 Score =  887 bits (2294), Expect = 0.0
 Identities = 444/485 (91%), Positives = 470/485 (96%)

Query: 1   MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS 60
           MAL VEK+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGS
Sbjct: 4   MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGS 63

Query: 61  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWC 120
           LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA+VFAWKGETLQEYWWC
Sbjct: 64  LHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWC 123

Query: 121 TEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 180
           TE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+I
Sbjct: 124 TERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSI 183

Query: 181 IRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN 240
           I++GLK DPK+YHKMK+R+VGVSEETTTGVKRLYQMQ NGTLLFPAINVNDSVTKSKFDN
Sbjct: 184 IKEGLKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDN 243

Query: 241 LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 300
           LYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQ
Sbjct: 244 LYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 303

Query: 301 ALMEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGL 360
           A MEGLQVLTLEDV+S+ADIFVTTTGNKDIIM+DHMKKMKNNAIVCNIGHFDNEIDMLGL
Sbjct: 304 ATMEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGL 363

Query: 361 ETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 420
           ET+PGVKRITIKPQTDRWVFPETN+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ
Sbjct: 364 ETHPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 423

Query: 421 LELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKP 480
           LELW EKS+GKYEKKVYVLPKHLDEKVAALHL KLGAKLT+L+K+QADYISV  +GPYKP
Sbjct: 424 LELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKP 483

Query: 481 LHYRY 485
            HYRY
Sbjct: 484 FHYRY 488
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Length = 183 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Length = 140 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 100.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.89
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.89
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.87
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.86
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.86
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.85
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.84
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.84
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.82
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.69
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.69
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.69
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.69
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.68
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.68
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.67
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.67
3rih_A293 Short chain dehydrogenase or reductase; structural 99.67
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.67
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.67
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.67
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.67
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.66
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.66
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.66
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.66
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.66
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.65
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.65
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.65
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.65
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.64
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.64
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.64
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.64
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.64
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.64
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.64
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.64
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.64
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.63
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.63
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.63
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.63
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.63
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.63
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.63
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.62
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.62
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.62
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.62
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.62
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.62
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.62
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.62
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.62
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.62
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.62
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.61
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.61
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.61
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.61
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.61
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.61
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.6
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.6
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.6
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.6
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.6
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.6
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.6
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.6
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.59
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.59
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.59
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.59
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.58
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.58
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.58
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.58
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.58
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.58
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.58
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.58
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.58
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.57
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.57
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.57
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.57
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.57
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.57
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.57
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.56
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.56
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.56
3cxt_A291 Dehydrogenase with different specificities; rossma 99.56
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.56
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.56
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.56
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.55
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.55
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.55
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.55
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.55
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.55
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.55
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.55
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.55
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.55
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.55
1spx_A278 Short-chain reductase family member (5L265); paral 99.55
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.55
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.54
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.54
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.54
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.54
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.54
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.54
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.54
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.54
4e4y_A244 Short chain dehydrogenase family protein; structur 99.54
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.53
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.53
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.53
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.53
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.53
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.53
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.53
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.53
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.53
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.53
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.52
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.52
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.52
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.52
1xkq_A280 Short-chain reductase family member (5D234); parra 99.52
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.52
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.52
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.52
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.52
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.52
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.52
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.52
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.52
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.51
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.51
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.51
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.51
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.51
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.51
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.51
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.51
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.51
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.5
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.5
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.5
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.5
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.5
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.49
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.49
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.49
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.49
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.49
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.49
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.49
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.48
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.47
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.47
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.47
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.47
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.47
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.47
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.47
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.47
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.46
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.46
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.45
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.45
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.45
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.45
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.45
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.45
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.44
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.44
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.44
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.44
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.43
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.43
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.43
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.43
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.43
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.43
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.43
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.42
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.42
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.42
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.42
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.42
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.42
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.42
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.42
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.42
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.41
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.41
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.41
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.41
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.41
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.41
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.41
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.41
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.4
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.4
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.4
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.4
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.4
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.4
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.4
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.39
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.39
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.39
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.39
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.39
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.39
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.39
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.38
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.38
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.38
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.38
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.37
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.37
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.36
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.36
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.35
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.34
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.34
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.34
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.34
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.33
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.33
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.32
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.32
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.32
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.32
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.31
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.3
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.28
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.27
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.27
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.24
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.2
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.18
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.12
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.08
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.03
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 98.96
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.9
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.89
3slk_A795 Polyketide synthase extender module 2; rossmann fo 98.88
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.87
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.86
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.86
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.79
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.73
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.71
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.64
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.63
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.62
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.56
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.56
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.54
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.44
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.41
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.4
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.37
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.35
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 98.35
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.35
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.32
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.32
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.31
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.29
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.28
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.27
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.24
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.23
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.2
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 98.19
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.19
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.15
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.15
1xq6_A253 Unknown protein; structural genomics, protein stru 98.14
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.13
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.12
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.1
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.09
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 98.07
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.06
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.05
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 98.05
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.04
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.04
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.03
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.98
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.97
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.94
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 97.93
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.92
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.92
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 97.91
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 97.91
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.9
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.9
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.9
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.88
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.88
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.88
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.87
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.86
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.86
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.86
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.86
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.85
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.84
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.83
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.83
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.82
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 97.82
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.82
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 97.82
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 97.81
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.81
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.8
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.8
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.8
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.79
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 97.79
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.78
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.77
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.76
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.75
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.75
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 97.72
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.72
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 97.72
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 96.9
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.71
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.71
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.71
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.71
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.7
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.68
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.67
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.67
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.67
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.67
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.65
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.64
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 97.64
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.62
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 97.62
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.62
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.62
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 97.61
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.61
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.6
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.58
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.58
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.57
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.57
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.57
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.56
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.56
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.55
4ezb_A317 Uncharacterized conserved protein; structural geno 97.55
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.54
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.54
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.53
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.52
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.51
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.5
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.5
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 97.49
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.46
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 97.46
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.45
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.45
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.44
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 97.44
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.43
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.41
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.41
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.41
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.4
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.38
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.37
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.35
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.34
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.33
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.31
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.31
4f6c_A 427 AUSA reductase domain protein; thioester reductase 97.3
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.3
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 97.27
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.27
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 97.26
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.25
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.24
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 97.24
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.24
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.2
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.2
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 97.19
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.17
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.17
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.16
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 97.16
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.16
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 97.14
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.13
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.12
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.1
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 97.1
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.1
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.1
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.09
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.08
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.07
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.06
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 97.06
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.05
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.05
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.05
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 97.04
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.04
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.03
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 97.03
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 97.02
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.02
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 97.01
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.01
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 97.01
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.0
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.0
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 97.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.99
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.99
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.98
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.98
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.97
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.96
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 96.95
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.94
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.93
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.93
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.93
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.91
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 96.9
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.9
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 96.9
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.9
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.9
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.89
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.89
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.87
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 96.87
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.87
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.86
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.86
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.86
3fbg_A346 Putative arginate lyase; structural genomics, unkn 96.86
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.85
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.84
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.82
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 96.81
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 96.81
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 96.8
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 96.79
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.79
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 96.79
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 96.77
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 96.77
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.76
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.75
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 96.75
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.74
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.74
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.73
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.73
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.72
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.72
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.72
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.71
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
Probab=100.00  E-value=3e-117  Score=913.35  Aligned_cols=462  Identities=63%  Similarity=0.987  Sum_probs=441.9

Q ss_pred             CcceecCCCchhhhhhhHHHHHhhCchHHHHHHHhCCCCCCCCceEEeeecccHhHHHHHHHHHhCCCEEEEEeCCCCCC
Q 011464           12 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFST   91 (485)
Q Consensus        12 ~~~~~~d~~~~~~g~~~~~~~~~~mp~l~~~~~~~~~~~pl~G~~i~~~lh~~~~t~~l~~~L~~~gA~v~~~~~~~~st   91 (485)
                      ++|+||||+||++||++|+||++|||+||++|++|+++|||+|+||++|||||+|||+||+||+++||||+|++||||||
T Consensus         3 ~~~~v~d~~la~~G~~~i~~ae~~MP~L~~~r~~~~~~kPl~G~rI~~~lH~t~~TavlietL~a~GAev~~~~cN~~ST   82 (464)
T 3n58_A            3 GSMVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFST   82 (464)
T ss_dssp             --CEESCGGGHHHHHHHHHHHHTTCHHHHHHHHHHTTTCTTTTCEEEEESCCSHHHHHHHHHHHHTTCEEEEECSSTTCC
T ss_pred             CCccccCchhHHHHHHHHHHHHhhCHHHHHHHHHHhccCCCCCCEEEEEEecHHHHHHHHHHHHHcCCeEEEecCCCCCC
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCCeEEEecCCCHHHHHHHHHHHHhcCCCCCCceEecCCCceeeeeecchhhhhhhhhcCCCCCCCCCch
Q 011464           92 QDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDN  171 (485)
Q Consensus        92 ~d~~a~al~~~g~~v~a~~~~~~~~~~~~~~~~~~~~~~~~p~~~~ddgg~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (485)
                      |||||+||++.|||||||||||.+|||||++++|.|+++.+|++|+|||||++.++|+|.++|++.   ..++.|   .+
T Consensus        83 qd~~aaal~~~gi~v~A~kget~eey~~~~~~~l~~~~~~~p~~ilDDGgDl~~~~h~~~~~~~~~---~~~~~~---~~  156 (464)
T 3n58_A           83 QDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAEAGE---DVLSNP---QS  156 (464)
T ss_dssp             CHHHHHHHHHTTCCEEECTTCCHHHHHHHHHHTTCCTTSCCCSEEEESSSHHHHHHHHHHHHHTTC---CCSSSC---CS
T ss_pred             cHHHHHHHHhcCCeEEEeCCCCHHHHHHHHHHHHcccCCCCCCEEEECchHHHHHHHhhhhhhccc---ccCCCC---Cc
Confidence            999999999999999999999999999999999999887789999999999999999999999874   344444   36


Q ss_pred             hHHHHHHHHHHhhccCCchhhhhhhhhhhcceeeccchhhhHHHHHHcCCceeecccccchhhhhHHhhhhhccccchHH
Q 011464          172 AEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG  251 (485)
Q Consensus       172 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~E~t~tGv~~l~~~~~~g~l~~pv~~v~~sv~e~~~~~~~~~~~~~~~~  251 (485)
                      +++.+++..+...+..++.+||+++++++|++|||||||+||++|.++|.+.+|++|||||++|+.|||.|++.++++++
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~G~~EeTtTGv~rL~~m~~~g~L~~PvinVnds~tK~~fDn~yG~~eslvdg  236 (464)
T 3n58_A          157 EEEEVLFAQIKKRMAATPGFFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDG  236 (464)
T ss_dssp             HHHHHHHHHHHHHHHHSTTHHHHHHHHCCEEEECSHHHHHHHHHHHHHTCCCSCEEECTTSHHHHTTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhcCcchhHHHHhhccceeeccccchHHHHHHHHcCCCCCCEEeeccHhhhhhhhhhhcchHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCccccCcEEEEECCChHHHHHHHHHHHCCCEEEEEeCChhHHHHHHHhCCcccCHHHHHHhHhHHhhhcCCccee
Q 011464          252 LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNKDII  331 (485)
Q Consensus       252 ~~~~~~~~l~Gk~vvV~G~GgIG~~iA~~l~~~Ga~Viv~dr~~~~~~~a~~~g~~v~~~~~~~~~~Div~~~~g~~~il  331 (485)
                      ++|.++..+.||+++|+|+|.||+++|++++++|++|+++++++.+..++.+.|+++.+++++++.+|+|+.++|+.+++
T Consensus       237 I~Ratg~~L~GKTVgVIG~G~IGr~vA~~lrafGa~Viv~d~dp~~a~~A~~~G~~vv~LeElL~~ADIVv~atgt~~lI  316 (464)
T 3n58_A          237 IRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEVVTLDDAASTADIVVTTTGNKDVI  316 (464)
T ss_dssp             HHHHHCCCCTTCEEEEECCSHHHHHHHHHHHHTTCEEEEECSSHHHHHHHHHTTCEECCHHHHGGGCSEEEECCSSSSSB
T ss_pred             HHHhcCCcccCCEEEEECcCHHHHHHHHHHHHCCCEEEEEeCCcchhhHHHhcCceeccHHHHHhhCCEEEECCCCcccc
Confidence            99999999999999999999999999999999999999999999887777888999999999999999999999999999


Q ss_pred             ehhHHhcCCCCeEEEecCCCCCcccccCccccccceeeecccchhhccccCcccccccccCceEEEEcCCCCCCccchhH
Q 011464          332 MVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSC  411 (485)
Q Consensus       332 ~~~~l~~m~~~aiv~N~g~~~~e~~~~~le~~~~~~~vnl~~~v~~~~lp~g~~~i~ll~~GrIVNisS~~g~~~~~~~~  411 (485)
                      +.++|+.||++++++|+||++.|++...+..   .-..++++++++|.+|+|+ +++++++||+||++++.|||+++|+.
T Consensus       317 ~~e~l~~MK~GAILINvGRgdvEID~~aL~~---~~~~~ik~~v~~~~~~~g~-~i~lLaeGrlvNL~~a~GhP~~vm~~  392 (464)
T 3n58_A          317 TIDHMRKMKDMCIVGNIGHFDNEIQVAALRN---LKWTNVKPQVDLIEFPDGK-RLILLSEGRLLNLGNATGHPSFVMSA  392 (464)
T ss_dssp             CHHHHHHSCTTEEEEECSSSTTTBTCGGGTT---SEEEEEETTEEEEECTTSC-EEEEEGGGSBHHHHHSCCSCHHHHHH
T ss_pred             CHHHHhcCCCCeEEEEcCCCCcccCHHHHHh---CccccccCCeeEEEeCCCC-EEEEEeCCceecccCCCCChHHHHhH
Confidence            9999999999999999999987888766664   3567899999999999999 99999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhcCCCCceEEeCchhHHHHHHHhhccccCceeeccChhhhhhccccCCCCCCCCCCCC
Q 011464          412 SFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485 (485)
Q Consensus       412 s~a~~al~~l~l~~~~~~~~~~~gV~~lp~~ld~~va~~~L~~~G~~~~~Lt~~q~~yl~~~~~g~~~~~~~~~  485 (485)
                      ||++|+++++++|.+.+  +|+++||.+|+.+|++||+++|+.+|++++.||++|++||++|.+||||||||||
T Consensus       393 sf~~Q~la~~~l~~~~~--~~~~~v~~lP~~lDe~VA~l~L~~~g~~l~~lt~~Q~~yl~~~~~gp~k~~~yry  464 (464)
T 3n58_A          393 SFTNQVLGQIELFTRTD--AYKNEVYVLPKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY  464 (464)
T ss_dssp             HHHHHHHHHHHHHHSGG--GCCSSEECCCHHHHHHHHHHHHGGGTCCCCCCCHHHHHHHTCCTTSCCSCTTCCC
T ss_pred             HHHHHHHHHHHHHhCcc--ccCCCeeECCHHHHHHHHHHHHHHcCCEeccCCHHHHHHcCCCCCCCCCCccCCC
Confidence            99999999999999987  8999999999999999999999999999999999999999999999999999999
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 1e-104
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 2e-50
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 4e-86
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 2e-38
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 1e-80
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 1e-65
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-05
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 4e-05
d1id1a_153 c.2.1.9 (A:) Rck domain from putative potassium ch 7e-05
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 8e-05
d1pjqa1113 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1e-04
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 2e-04
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-04
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 4e-04
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 4e-04
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 4e-04
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 5e-04
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 6e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-04
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 7e-04
d2fy8a1129 c.2.1.9 (A:116-244) Potassium channel-related prot 7e-04
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 8e-04
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 9e-04
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 0.001
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.001
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.002
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 0.002
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.002
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 0.002
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 0.003
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 0.003
d1np3a2182 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomer 0.003
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.003
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.003
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.004
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 0.004
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 0.004
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]

 Score =  311 bits (798), Expect = e-104
 Identities = 138/287 (48%), Positives = 190/287 (66%), Gaps = 12/287 (4%)

Query: 13  EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIE 72
           + KVKD+S A FG++++E++E EMPGLM  R E+G  QP K AKITG LHMT++ A+LIE
Sbjct: 2   KSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIE 61

Query: 73  TLTALGAEVRWCSCNIFSTQDHAAAAI-ARDSASVFAWKGETLQEYWWCTEKALDWG--P 129
           TL  LGA++RWCSCNI+ST D+AAAA+   ++ +VFAWK ETL+EYWWC E AL WG   
Sbjct: 62  TLQKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGD 121

Query: 130 GGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADP 189
             GPD+IVDDGGDATLL+H+GV+ E++YE+   LPDP    N E +  LT++++ +  +P
Sbjct: 122 DNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSILKNP 181

Query: 190 KKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDN------LYG 243
           KK+  + ++++GVSEETTTGV RL +M +   LLF AINVND+VTK K+D+         
Sbjct: 182 KKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDHPAFVMSFSF 241

Query: 244 CRHSLP--DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARV 288
           C  +    D            KV ++  + D        LK+  A +
Sbjct: 242 CNQTFAQLDLWQNKDTNKYENKVYLLPKHLDEKVAL-YHLKKLNASL 287
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Length = 113 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Length = 182 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 99.97
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.97
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.86
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.86
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.85
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.85
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.85
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.84
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.84
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.84
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.84
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.84
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.84
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.83
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.83
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.83
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.83
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.83
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.83
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.82
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.82
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.82
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.82
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.82
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.81
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.8
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.8
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.8
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.8
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.8
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.79
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.79
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.79
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.78
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.78
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.77
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.77
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.77
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.75
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.74
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.74
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.73
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.73
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.73
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.72
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.72
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.68
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.68
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.67
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.65
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.64
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.64
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.62
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.6
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.58
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.57
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.57
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.57
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.55
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.51
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.51
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.51
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.5
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.5
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.49
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.47
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.46
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.44
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.43
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.41
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.4
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.39
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.37
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.31
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.21
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.0
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.95
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.28
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.23
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.22
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.16
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.14
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.1
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.03
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.94
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.93
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.91
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.9
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.9
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.88
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.73
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.72
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.7
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 97.65
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.64
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.63
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.61
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.58
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.54
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.51
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.43
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.39
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.37
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.36
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.35
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.34
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.33
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.3
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.29
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.26
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.25
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.23
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.19
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.18
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.17
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.16
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.14
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.07
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.01
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.92
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.9
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.89
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.88
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.82
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.72
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.68
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.59
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.56
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.53
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.52
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.52
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 96.47
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.46
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.45
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.38
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.37
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.23
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.2
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.07
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.02
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.86
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.8
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 95.78
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 95.7
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 95.66
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.66
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.65
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.63
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.62
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.5
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 95.46
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.46
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.44
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.44
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.38
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.37
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.33
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.31
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.3
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.11
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.1
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.08
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.06
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.06
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.01
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.95
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.93
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.92
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.91
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.84
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.75
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.74
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.68
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.49
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.43
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.24
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.19
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.16
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.15
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.14
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 94.1
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.07
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.02
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.88
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.88
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.84
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 93.84
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.82
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.81
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 93.77
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.66
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.66
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 93.5
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.48
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.46
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 93.39
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 93.37
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.33
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.25
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.91
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 92.64
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.62
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.58
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 92.53
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.52
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 92.43
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.43
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.31
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.3
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 92.22
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.18
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.07
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.02
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.0
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.94
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 91.77
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.68
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.58
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.55
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 91.55
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 91.37
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.18
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.08
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.07
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.02
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.98
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.87
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.77
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 90.7
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 90.49
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.45
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.42
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.42
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.41
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 90.02
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.01
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.93
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.82
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.8
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 89.71
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 89.61
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 89.37
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.35
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.16
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 88.98
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.75
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.68
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 88.55
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 88.52
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.51
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.19
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 88.05
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 88.02
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.0
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.93
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 87.93
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 87.74
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 87.69
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 87.59
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 87.48
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.46
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 87.36
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.27
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 87.13
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 87.13
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 87.11
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 86.92
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 86.63
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.6
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 86.34
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 86.24
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 86.06
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 86.03
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 85.83
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 85.67
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.21
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 85.1
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 85.02
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 84.96
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 84.8
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.59
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 84.58
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 84.56
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 84.2
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 83.5
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.45
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 83.22
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 82.85
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.25
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 82.16
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.73
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 81.16
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 81.09
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 81.03
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 80.98
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 80.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 80.49
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 80.42
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 80.27
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 80.06
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 80.05
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 80.01
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]

Probab=100.00  E-value=5.1e-86  Score=646.08  Aligned_cols=310  Identities=58%  Similarity=1.024  Sum_probs=301.1

Q ss_pred             CcceecCCCchhhhhhhHHHHHhhCchHHHHHHHhCCCCCCCCceEEeeecccHhHHHHHHHHHhCCCEEEEEeCCCCCC
Q 011464           12 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFST   91 (485)
Q Consensus        12 ~~~~~~d~~~~~~g~~~~~~~~~~mp~l~~~~~~~~~~~pl~G~~i~~~lh~~~~t~~l~~~L~~~gA~v~~~~~~~~st   91 (485)
                      +.|+||||+||++||++|+||++|||+||++|++|..+|||+|+||++|||||+|||+||+||+++||+|+||+|||+||
T Consensus         1 ~~s~VkDisLA~~G~~~IewAe~eMP~L~alr~~~~~~kPlkG~rIagcLHmt~qTAvLietL~~~GAeV~~~scNp~ST   80 (313)
T d1v8ba2           1 NKSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYST   80 (313)
T ss_dssp             CCCBCSCGGGHHHHHHHHHHHGGGCHHHHHHHHHSTTTCTTTTCEEEEESCCSHHHHHHHHHHHHTTCEEEEECSSSSCC
T ss_pred             CCCccCChhhhHHhHHHHHHHHHHCHHHHHHHHHHhccCCCCCCEEEEEEccHHHHHHHHHHHHHhCCeeEEeccCCccc
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHh-CCCeEEEecCCCHHHHHHHHHHHHhcCCCC--CCceEecCCCceeeeeecchhhhhhhhhcCCCCCCCC
Q 011464           92 QDHAAAAIAR-DSASVFAWKGETLQEYWWCTEKALDWGPGG--GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAS  168 (485)
Q Consensus        92 ~d~~a~al~~-~g~~v~a~~~~~~~~~~~~~~~~~~~~~~~--~p~~~~ddgg~l~~~~~~~~~~~~~~~~~~~~~~~~~  168 (485)
                      ||||||||++ .|++||||||+|.+|||||++++|.|+++.  +|++|+|||||++.++|.|.+.|+.++....++.|..
T Consensus        81 QD~vAAAl~~~~gi~VfAwkGet~eey~~~i~~~L~~~dg~~~~P~~IlDDGgDlt~~vh~g~~~E~l~~~~~~lp~p~~  160 (313)
T d1v8ba2          81 ADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEK  160 (313)
T ss_dssp             CHHHHHHHTTSTTEEEECCTTCCHHHHHHHHHHHHCCSSSSSCSCSEEEESSSHHHHHHHHHHHHHHHHHHHCCCCCGGG
T ss_pred             chHHHHHhhccCCceEEEecCCCHHHHHHHHHHHHhcCCCCCCCCcEEeehhHHHHHHHHhcchhccccccccccCCCCC
Confidence            9999999987 799999999999999999999999997763  8999999999999999999999999999999999999


Q ss_pred             CchhHHHHHHHHHHhhccCCchhhhhhhhhhhcceeeccchhhhHHHHHHcCCceeecccccchhhhhHHhhhhhccccc
Q 011464          169 TDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSL  248 (485)
Q Consensus       169 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~E~t~tGv~~l~~~~~~g~l~~pv~~v~~sv~e~~~~~~~~~~~~~  248 (485)
                      +.+.++.+++..+...+.+++.+|++++++++|++|||||||+||++|.+.|.+.||++||||+++|+.|+         
T Consensus       161 ~~n~~~~~~~~~lk~~~~~~~~~~~~~~~~i~GvsEETTTGV~RL~~m~~~g~L~fPainVNDsvtK~~F~---------  231 (313)
T d1v8ba2         161 AKNEEERCFLTLLKNSILKNPKKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYD---------  231 (313)
T ss_dssp             CSSHHHHHHHHHHHHHHTTCTTHHHHHHTTCCEEEECSHHHHHHHHHHHHTTCCCSEEEECTTSHHHHTTH---------
T ss_pred             CCCHHHHHHHHHHHHHHhhCcHHHHHhhhcEEEEeCCCCccHHhHHHHHHcCcceeeeEecCcccCHHHhC---------
Confidence            99999999999999999999999999999999999999999999999999999999999999999999874         


Q ss_pred             hHHHHhhcCccccCcEEEEECCChHHHHHHHHHHHCCCEEEEEeCChhHHHHHHHhCCcccCHHHHHHhHhHHhhhcCCc
Q 011464          249 PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVLSDADIFVTTTGNK  328 (485)
Q Consensus       249 ~~~~~~~~~~~l~Gk~vvV~G~GgIG~~iA~~l~~~Ga~Viv~dr~~~~~~~a~~~g~~v~~~~~~~~~~Div~~~~g~~  328 (485)
                                                                                                      
T Consensus       232 --------------------------------------------------------------------------------  231 (313)
T d1v8ba2         232 --------------------------------------------------------------------------------  231 (313)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ceeehhHHhcCCCCeEEEecCCCCCcccccCccccccceeeecccchhhccccCcccccccccCceEEEEcCCCCCCccc
Q 011464          329 DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFV  408 (485)
Q Consensus       329 ~il~~~~l~~m~~~aiv~N~g~~~~e~~~~~le~~~~~~~vnl~~~v~~~~lp~g~~~i~ll~~GrIVNisS~~g~~~~~  408 (485)
                                                                                                 ||+++
T Consensus       232 ---------------------------------------------------------------------------~P~~v  236 (313)
T d1v8ba2         232 ---------------------------------------------------------------------------HPAFV  236 (313)
T ss_dssp             ---------------------------------------------------------------------------SCHHH
T ss_pred             ---------------------------------------------------------------------------CcHHH
Confidence                                                                                       67899


Q ss_pred             hhHHHHHHHHHHHHHHHhhhcCCCCceEEeCchhHHHHHHHhhccccCceeeccChhhhhhccccCCCCCCCCCCCC
Q 011464          409 MSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485 (485)
Q Consensus       409 ~~~s~a~~al~~l~l~~~~~~~~~~~gV~~lp~~ld~~va~~~L~~~G~~~~~Lt~~q~~yl~~~~~g~~~~~~~~~  485 (485)
                      |++||++|++++++++.+.+.+.+.++||.+|+++|++||+++|+.+|++++.||++|++||+++.+|||||++|||
T Consensus       237 Md~SFanQ~La~~~l~~~~~~~~~~~~Vy~lP~~lDe~vA~l~L~~~g~~id~Lt~~Q~~Yl~~~~~gp~k~~~y~y  313 (313)
T d1v8ba2         237 MSFSFCNQTFAQLDLWQNKDTNKYENKVYLLPKHLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY  313 (313)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSSSCCSSEECCCHHHHHHHHHHHHGGGTCCCCCCCHHHHHHHTCCTTSCCSCTTCCC
T ss_pred             HHHHHHhHHHHHHHHHhcCcccccCCcEEECChHHHHHHHHHHHHhcCCEeccCCHHHHHHCCCCCCCCCCCCCCCC
Confidence            99999999999999999887678999999999999999999999999999999999999999999999999999999
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure