Citrus Sinensis ID: 011473

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
ccEEEEccccccEEEEEEEccccEEEEEEEEcccccEEEEcccccccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEcccccccccccccEEEcccccHHHHHHccccEEEEEEcccccEEEEEccccEEEEEEEcccEEEEEEEccHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccEEEcccccEEEEEEccccEEEEEEEcEEEEEEccccHHHHHHHHHHHcccccccccccHHHHcccccccccccccccHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEccccccHHHHHHHHHHHcccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHcccccccccccccEEEEEEEEccc
ccEEEEcccccccEEEEEccccccEEEEEEcccccEEEEEcccccccccEEEEHcccccEEEEEEcccccEEEEEccccEEEEEccccccccccEEEEEEEccccHHHHHHcccccEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcHHHHHHHHHHHcccccccccccccccEEEEHHHHcccccccccEEEEEccccEEEEEcEcEEEEEEEEcccEEEEEccccccHHHHHEEEHccccccccEEEEEHHHcccHHHcccccccEEEEEEEcccEEEEEEccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEEcccEEEEcccccccccccccccccEccccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEEcc
mmlmirlpfipgaVEWVYKqgdvkaglaisdrnssfvhiydaradsnepliskkvhmgpvkvmrynpvfdtvisaddkgiieywsphtlqfpesevsfrlkSDTNLFEILKSKTtvsaievspdgkqfsitspdrrIRVFWFRTGKLRRVYDESLEVAQDlqrsdaplyrlEAIDFGRRMAVEKEIEktetappsnaifdessNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYqgdrsskkvrkipaaaananeskepfsdptllccafkrhriylfsrrepeepedatkgrdifnekpppdellavsdignsvttslpdnvILHTtmgdihmklypeecpktVENFTTHCRNEYYNNLIFHRVIKGFMiqtgdplgdgtggqsiwgreFEDEFHkslrhdrpftvsmanagpntngsqffittvatpwldnkhTVFGRVIKGMDVVQAIEKVktdkndkpyqdvkilnvtvpks
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDaradsnepliskKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSkttvsaievspdgkqfsitspdrrirVFWFrtgklrrvydESLEvaqdlqrsdaplyrLEAIDFGRRMAVEKEIektetappsnaifdESSNFLIYATLLGIKIVNLHTNKVSrilgkvenndrFLRIAlyqgdrsskkvrKIPAAaananeskepfsdPTLLCCAFKRHRIYlfsrrepeepedatkgrdifnekpPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKvktdkndkpyqdvkilnvtvpks
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
**LMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVS****QFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAV***************IFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQ***************************PTLLCCAFKRHRIYLF****************************AVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHK*******FTV********TNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKT********DVKILN******
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQ**********RLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQ****************************TLLCCAFKRHRIYLF***************DIFNEKPP*****************LPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVP**
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRRE********KGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRRE********KGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
Q8CEC6646 Peptidylprolyl isomerase yes no 0.969 0.727 0.519 1e-145
Q96BP3646 Peptidylprolyl isomerase yes no 0.973 0.730 0.515 1e-144
Q29RZ2644 Peptidylprolyl isomerase yes no 0.973 0.732 0.515 1e-143
Q5NVL7646 Peptidylprolyl isomerase yes no 0.973 0.730 0.515 1e-143
P0C1J0630 Peptidyl-prolyl cis-trans N/A no 0.958 0.738 0.506 1e-135
O74942610 Peptidyl-prolyl cis-trans yes no 0.975 0.775 0.423 1e-101
Q4WCR3161 Peptidyl-prolyl cis-trans no no 0.319 0.962 0.541 2e-45
Q7SF72163 Peptidyl-prolyl cis-trans N/A no 0.319 0.950 0.541 1e-44
Q4I1Y1162 Peptidyl-prolyl cis-trans no no 0.319 0.956 0.529 3e-44
Q5ASQ0162 Peptidyl-prolyl cis-trans no no 0.319 0.956 0.529 4e-44
>sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 Back     alignment and function desciption
 Score =  513 bits (1322), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/491 (51%), Positives = 347/491 (70%), Gaps = 21/491 (4%)

Query: 1   MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPL-ISKKVHMGP 59
           M+ M++L + PG  EW+Y  GD  + +A S++++  + IYD R D N+PL I  K+H+ P
Sbjct: 167 MINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRGD-NQPLHIFDKLHVSP 225

Query: 60  VKVMRYNPVFDTVISADDKGIIEYWS--PHTLQFPESEVSFRLKSDTNLFEILKSKTTVS 117
           +  +R NPV+  V+S+D  G+IEYW+  PH  +FP++ V++  K+DT+L+E  K K   +
Sbjct: 226 LTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKN-VNWEYKTDTDLYEFAKCKAYPT 284

Query: 118 AIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFG 177
           +I  SPDGK+ +    DR++R+F F TGKL RV+DESL +  +LQ+    L  +E   FG
Sbjct: 285 SICFSPDGKKIATIGSDRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDME---FG 341

Query: 178 RRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRF 237
           RRMAVE+E+EK +     N +FDE+ +F++Y T+LGIK++N+ TN+  RILGK EN  R 
Sbjct: 342 RRMAVERELEKVDAVRLVNIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQEN-IRV 400

Query: 238 LRIALYQGDRSSKKVRKIPAAAANANESKEPF-----SDPTLLCCAFKRHRIYLFSRREP 292
           +++AL+QG   +KK R   AA      S+ P      +DPT++C +FK++R Y+F++REP
Sbjct: 401 MQLALFQG--IAKKHR--AAATIEMKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREP 456

Query: 293 EEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPK 352
           E+ + A   RD+FNEKP  +E++A +        S  D+ I+HT+MGDIH+KL+P ECPK
Sbjct: 457 EDTKTADSDRDVFNEKPSKEEVMAATQAEGPKRVS--DSAIVHTSMGDIHIKLFPVECPK 514

Query: 353 TVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDR 412
           TVENF  H RN YYN   FHR+IKGFMIQTGDP G G GG+SIWG EFEDEFH +LRHDR
Sbjct: 515 TVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDR 574

Query: 413 PFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTD-KNDKP 471
           P+T+SMANAG NTNGSQFFIT V TPWLDNKHTVFGRV KGM+VVQ I  VK + K DKP
Sbjct: 575 PYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKP 634

Query: 472 YQDVKILNVTV 482
           Y+DV I+N+TV
Sbjct: 635 YEDVSIINITV 645
Putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 Back     alignment and function description
>sp|O74942|CYP9_SCHPO Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 Back     alignment and function description
>sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q7SF72|PPIL1_NEUCR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-1 PE=3 SV=2 Back     alignment and function description
>sp|Q4I1Y1|PPIL1_GIBZE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
356550125 616 PREDICTED: peptidylprolyl isomerase doma 1.0 0.787 0.913 0.0
255576357 623 WD-repeat protein, putative [Ricinus com 1.0 0.778 0.905 0.0
359479380548 PREDICTED: peptidylprolyl isomerase doma 1.0 0.885 0.898 0.0
297734824 5747 unnamed protein product [Vitis vinifera] 1.0 0.084 0.898 0.0
449443428 624 PREDICTED: peptidylprolyl isomerase doma 0.997 0.775 0.900 0.0
356543564 616 PREDICTED: peptidylprolyl isomerase doma 1.0 0.787 0.905 0.0
224103047 620 predicted protein [Populus trichocarpa] 1.0 0.782 0.888 0.0
297818928 631 peptidyl-prolyl cis-trans isomerase cycl 1.0 0.768 0.855 0.0
343172078499 peptidyl-prolyl isomerase domain and WD 1.0 0.971 0.859 0.0
22331588 631 peptidylprolyl isomerase domain and WD r 1.0 0.768 0.849 0.0
>gi|356550125|ref|XP_003543440.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/485 (91%), Positives = 470/485 (96%)

Query: 1   MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPV 60
           MM+MIRLP+IPGAV+WVYKQGDVKA LAISDRNSSFVHIYDARA SN+P+ISK++HMGP+
Sbjct: 132 MMVMIRLPYIPGAVDWVYKQGDVKARLAISDRNSSFVHIYDARAGSNDPIISKEIHMGPI 191

Query: 61  KVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIE 120
           KVM+YNPV D+V+SAD KGIIEYWSP TLQFPE+EV+F+LKSDTNLFEI K KT+VSAIE
Sbjct: 192 KVMKYNPVCDSVLSADAKGIIEYWSPATLQFPENEVNFKLKSDTNLFEIAKCKTSVSAIE 251

Query: 121 VSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRM 180
           VSPDGKQFSITSPDRRIRVFW+RTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRM
Sbjct: 252 VSPDGKQFSITSPDRRIRVFWYRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRM 311

Query: 181 AVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRI 240
           AVEKEIEKTE+AP  NA+FDES+NFLIYATLLGIKIVNLHTNKV+RILGKVENNDRFLRI
Sbjct: 312 AVEKEIEKTESAPLPNAVFDESANFLIYATLLGIKIVNLHTNKVARILGKVENNDRFLRI 371

Query: 241 ALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATK 300
           ALYQGDR+SKKVRKIP+AAANANESKEP +DPTLLCCAFK+HRIYLFSRREPEEPEDATK
Sbjct: 372 ALYQGDRNSKKVRKIPSAAANANESKEPLTDPTLLCCAFKKHRIYLFSRREPEEPEDATK 431

Query: 301 GRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTH 360
           GRD+FNEKPP DELL+VSDIG SVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTH
Sbjct: 432 GRDVFNEKPPADELLSVSDIGKSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTH 491

Query: 361 CRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMAN 420
           CRN YY+NLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMAN
Sbjct: 492 CRNGYYDNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMAN 551

Query: 421 AGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNV 480
           AGPNTNGSQFFITTVATPWLDNKHTVFGRV KGMDVVQAIEKVKTDK DKPYQDVKILNV
Sbjct: 552 AGPNTNGSQFFITTVATPWLDNKHTVFGRVAKGMDVVQAIEKVKTDKTDKPYQDVKILNV 611

Query: 481 TVPKS 485
           TVPKS
Sbjct: 612 TVPKS 616

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255576357|ref|XP_002529071.1| WD-repeat protein, putative [Ricinus communis] gi|223531483|gb|EEF33315.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359479380|ref|XP_002269959.2| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734824|emb|CBI17058.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443428|ref|XP_004139479.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Cucumis sativus] gi|449501645|ref|XP_004161425.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356543564|ref|XP_003540230.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224103047|ref|XP_002312902.1| predicted protein [Populus trichocarpa] gi|222849310|gb|EEE86857.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297818928|ref|XP_002877347.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297323185|gb|EFH53606.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|343172078|gb|AEL98743.1| peptidyl-prolyl isomerase domain and WD repeat-containing protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|22331588|ref|NP_190046.2| peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Arabidopsis thaliana] gi|17065154|gb|AAL32731.1| putative protein [Arabidopsis thaliana] gi|30725438|gb|AAP37741.1| At3g44600 [Arabidopsis thaliana] gi|332644399|gb|AEE77920.1| peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
TAIR|locus:2076003631 CYP71 "cyclophilin 71" [Arabid 1.0 0.768 0.849 7.3e-233
UNIPROTKB|F1NAJ2657 PPWD1 "Uncharacterized protein 0.973 0.718 0.519 1.1e-133
RGD|1310204646 Ppwd1 "peptidylprolyl isomeras 0.973 0.730 0.517 1.1e-133
MGI|MGI:2443069646 Ppwd1 "peptidylprolyl isomeras 0.973 0.730 0.517 1.4e-133
UNIPROTKB|B4DWR9490 PPWD1 "cDNA FLJ53227, highly s 0.973 0.963 0.515 3.8e-133
UNIPROTKB|F5H7P7616 PPWD1 "Peptidylprolyl isomeras 0.973 0.766 0.515 3.8e-133
UNIPROTKB|Q96BP3646 PPWD1 "Peptidylprolyl isomeras 0.973 0.730 0.515 3.8e-133
UNIPROTKB|F1SKT8646 PPWD1 "Peptidylprolyl isomeras 0.973 0.730 0.513 4.8e-133
UNIPROTKB|Q29RZ2644 PPWD1 "Peptidylprolyl isomeras 0.973 0.732 0.515 6.2e-133
UNIPROTKB|F1SKT6480 LOC100512871 "Uncharacterized 0.967 0.977 0.514 1e-132
TAIR|locus:2076003 CYP71 "cyclophilin 71" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2246 (795.7 bits), Expect = 7.3e-233, P = 7.3e-233
 Identities = 412/485 (84%), Positives = 456/485 (94%)

Query:     1 MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPV 60
             MM MIRLP+IPGAVEWVYKQGDVKA LA+SDR+S FVHIYD R+ SNEP+ SK++HM P+
Sbjct:   147 MMAMIRLPYIPGAVEWVYKQGDVKAKLAVSDRDSLFVHIYDPRSGSNEPIASKEIHMNPI 206

Query:    61 KVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIE 120
             KVM+YNPV DT+IS D KGIIEYWS  TLQFPE EV+F+LKSDTNLFEI+K KTT+SAIE
Sbjct:   207 KVMKYNPVSDTMISGDTKGIIEYWSATTLQFPEDEVNFKLKSDTNLFEIIKCKTTISAIE 266

Query:   121 VSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRM 180
             VSPDGKQFSIT+PDRRIRVFWFRTGKLRRVYDESL VAQDLQRSDAPLYRLEAIDFGRRM
Sbjct:   267 VSPDGKQFSITAPDRRIRVFWFRTGKLRRVYDESLVVAQDLQRSDAPLYRLEAIDFGRRM 326

Query:   181 AVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRI 240
             AVEKE+EKTE+AP  NA+FDESSNFLIYAT LGIK++NLHTN V+RILGKVE+N+R+LR+
Sbjct:   327 AVEKELEKTESAPQPNAVFDESSNFLIYATFLGIKVINLHTNTVARILGKVESNERYLRV 386

Query:   241 ALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATK 300
             ALYQGD+  KKVRKIPAAAAN NESKEP +DPT+LCCAFK+HRIY+FSRREPEEPEDA++
Sbjct:   387 ALYQGDQGGKKVRKIPAAAANVNESKEPLTDPTILCCAFKKHRIYMFSRREPEEPEDASQ 446

Query:   301 GRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTH 360
             GRD+FNEKP  DEL++VSDIGNS TTSLP+NVI+HTT+GDIHMKLYPEECPKTVENFTTH
Sbjct:   447 GRDVFNEKPAADELMSVSDIGNSATTSLPENVIMHTTLGDIHMKLYPEECPKTVENFTTH 506

Query:   361 CRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMAN 420
             CRN YY+N +FHRVI+GFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFT+SMAN
Sbjct:   507 CRNGYYDNHLFHRVIRGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTLSMAN 566

Query:   421 AGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNV 480
             AGPNTNGSQFFITTVATPWLDNKHTVFGRV+KGMDVVQ IEKVKTDKND+PYQDVKILNV
Sbjct:   567 AGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIEKVKTDKNDRPYQDVKILNV 626

Query:   481 TVPKS 485
             TVPKS
Sbjct:   627 TVPKS 631
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=ISS
GO:0003682 "chromatin binding" evidence=IDA
GO:0009909 "regulation of flower development" evidence=RCA;IMP
GO:0009933 "meristem structural organization" evidence=RCA;IMP
GO:0010082 "regulation of root meristem growth" evidence=IMP
GO:0010305 "leaf vascular tissue pattern formation" evidence=IMP
GO:0010338 "leaf formation" evidence=IMP
GO:0010358 "leaf shaping" evidence=IMP
GO:0031060 "regulation of histone methylation" evidence=IMP
GO:0042393 "histone binding" evidence=IDA
GO:0048440 "carpel development" evidence=IMP
GO:0048443 "stamen development" evidence=IMP
GO:0048453 "sepal formation" evidence=RCA;IMP
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0000003 "reproduction" evidence=RCA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006310 "DNA recombination" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006325 "chromatin organization" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0010074 "maintenance of meristem identity" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
UNIPROTKB|F1NAJ2 PPWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310204 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443069 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWR9 PPWD1 "cDNA FLJ53227, highly similar to Peptidylprolyl isomerase domain and WDrepeat-containing protein 1 (EC 5.2.1.8)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7P7 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96BP3 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKT8 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RZ2 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKT6 LOC100512871 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CEC6PPWD1_MOUSE5, ., 2, ., 1, ., 80.51930.96900.7275yesno
Q5NVL7PPWD1_PONAB5, ., 2, ., 1, ., 80.51530.97310.7306yesno
Q96BP3PPWD1_HUMAN5, ., 2, ., 1, ., 80.51530.97310.7306yesno
Q29RZ2PPWD1_BOVIN5, ., 2, ., 1, ., 80.51530.97310.7329yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.766
4th Layer5.2.1.80.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022051001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (620 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00034779001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (467 aa)
   •    0.440
GSVIVG00037110001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (512 aa)
   •    0.431

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-111
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 2e-77
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 8e-71
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 2e-69
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 2e-67
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 3e-67
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-65
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 6e-62
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 3e-60
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 7e-50
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 3e-47
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-46
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-30
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 4e-27
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-26
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 9e-10
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 3e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.002
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information 
 Score =  324 bits (831), Expect = e-111
 Identities = 123/148 (83%), Positives = 138/148 (93%)

Query: 333 ILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGG 392
           I+HTT GDIH++L+PEE PKTVENFTTH RN YYNN IFHRVIKGFMIQTGDP GDGTGG
Sbjct: 1   IIHTTKGDIHIRLFPEEAPKTVENFTTHARNGYYNNTIFHRVIKGFMIQTGDPTGDGTGG 60

Query: 393 QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIK 452
           +SIWG+EFEDEF  SL+HDRP+T+SMANAGPNTNGSQFFITTVATPWLDNKHTVFGRV+K
Sbjct: 61  ESIWGKEFEDEFSPSLKHDRPYTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVK 120

Query: 453 GMDVVQAIEKVKTDKNDKPYQDVKILNV 480
           GMDVVQ IE VKTDKND+PY+D+KI+N+
Sbjct: 121 GMDVVQRIENVKTDKNDRPYEDIKIINI 148

This group consists of several hypothetical and putative eukaryotic and bacterial proteins which have a cyclophilin domain and a WD40 domain. Function of the protein is not known. Length = 148
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
PTZ00221249 cyclophilin; Provisional 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.96
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.96
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.96
KOG0286343 consensus G-protein beta subunit [General function 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.94
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.93
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.92
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.92
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.92
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.92
PTZ00420568 coronin; Provisional 99.92
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.92
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.91
KOG0315311 consensus G-protein beta subunit-like protein (con 99.91
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.91
KOG0645312 consensus WD40 repeat protein [General function pr 99.91
KOG0296399 consensus Angio-associated migratory cell protein 99.9
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.9
KOG0295406 consensus WD40 repeat-containing protein [Function 99.9
PTZ00421493 coronin; Provisional 99.9
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.9
KOG0286343 consensus G-protein beta subunit [General function 99.9
KOG0295406 consensus WD40 repeat-containing protein [Function 99.9
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.89
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.89
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.89
KOG0315311 consensus G-protein beta subunit-like protein (con 99.89
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.88
PTZ00421493 coronin; Provisional 99.88
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.88
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.87
KOG0294362 consensus WD40 repeat-containing protein [Function 99.86
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.86
PLN00181793 protein SPA1-RELATED; Provisional 99.86
KOG0283712 consensus WD40 repeat-containing protein [Function 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.86
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.86
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.85
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.85
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.85
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.84
KOG0289506 consensus mRNA splicing factor [General function p 99.84
KOG0645312 consensus WD40 repeat protein [General function pr 99.84
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.84
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.84
KOG0283712 consensus WD40 repeat-containing protein [Function 99.83
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
PLN00181793 protein SPA1-RELATED; Provisional 99.83
KOG0303472 consensus Actin-binding protein Coronin, contains 99.83
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.83
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.83
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
KOG0643327 consensus Translation initiation factor 3, subunit 99.83
PTZ00420568 coronin; Provisional 99.82
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.82
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.82
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.82
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.82
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.81
KOG0293519 consensus WD40 repeat-containing protein [Function 99.81
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.81
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.81
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.81
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.81
KOG0267 825 consensus Microtubule severing protein katanin p80 99.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.8
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.8
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.8
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.79
KOG0289506 consensus mRNA splicing factor [General function p 99.79
KOG0646476 consensus WD40 repeat protein [General function pr 99.79
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.78
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.78
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.78
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.77
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.77
KOG0267 825 consensus Microtubule severing protein katanin p80 99.77
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.77
KOG0643327 consensus Translation initiation factor 3, subunit 99.76
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.76
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.76
KOG0300481 consensus WD40 repeat-containing protein [Function 99.75
KOG0296399 consensus Angio-associated migratory cell protein 99.75
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.75
KOG0772641 consensus Uncharacterized conserved protein, conta 99.74
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.73
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.73
KOG4283397 consensus Transcription-coupled repair protein CSA 99.72
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.72
KOG0641350 consensus WD40 repeat protein [General function pr 99.72
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.72
KOG2096420 consensus WD40 repeat protein [General function pr 99.71
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.71
KOG1273405 consensus WD40 repeat protein [General function pr 99.71
KOG0772641 consensus Uncharacterized conserved protein, conta 99.71
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.71
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.71
KOG1273405 consensus WD40 repeat protein [General function pr 99.69
KOG0639705 consensus Transducin-like enhancer of split protei 99.69
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.68
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.67
KOG0302440 consensus Ribosome Assembly protein [General funct 99.67
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.67
KOG0270463 consensus WD40 repeat-containing protein [Function 99.66
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.66
KOG0302440 consensus Ribosome Assembly protein [General funct 99.66
KOG1274 933 consensus WD40 repeat protein [General function pr 99.65
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.65
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 99.65
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.65
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.65
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.64
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.63
KOG1539910 consensus WD repeat protein [General function pred 99.63
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.63
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.62
KOG0641350 consensus WD40 repeat protein [General function pr 99.62
KOG1274 933 consensus WD40 repeat protein [General function pr 99.62
KOG2096420 consensus WD40 repeat protein [General function pr 99.62
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.6
KOG4328498 consensus WD40 protein [Function unknown] 99.6
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.59
KOG0294362 consensus WD40 repeat-containing protein [Function 99.59
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.59
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.59
KOG0270463 consensus WD40 repeat-containing protein [Function 99.58
KOG0303472 consensus Actin-binding protein Coronin, contains 99.58
KOG0300481 consensus WD40 repeat-containing protein [Function 99.58
KOG4283397 consensus Transcription-coupled repair protein CSA 99.57
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.57
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.57
KOG2055514 consensus WD40 repeat protein [General function pr 99.57
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.57
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.56
KOG1539910 consensus WD repeat protein [General function pred 99.55
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.54
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.53
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.52
KOG2048 691 consensus WD40 repeat protein [General function pr 99.51
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.51
KOG0646476 consensus WD40 repeat protein [General function pr 99.49
KOG2048 691 consensus WD40 repeat protein [General function pr 99.48
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.47
KOG0639705 consensus Transducin-like enhancer of split protei 99.43
KOG4328498 consensus WD40 protein [Function unknown] 99.43
KOG2110391 consensus Uncharacterized conserved protein, conta 99.43
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.42
KOG2106626 consensus Uncharacterized conserved protein, conta 99.41
KOG0771398 consensus Prolactin regulatory element-binding pro 99.41
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.4
COG2319466 FOG: WD40 repeat [General function prediction only 99.4
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.39
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.38
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.38
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.37
KOG0649325 consensus WD40 repeat protein [General function pr 99.37
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.37
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.37
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.37
KOG2110391 consensus Uncharacterized conserved protein, conta 99.35
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.34
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.33
KOG1188376 consensus WD40 repeat protein [General function pr 99.33
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.33
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.33
COG2319466 FOG: WD40 repeat [General function prediction only 99.33
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.31
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.3
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.3
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.3
PRK01742429 tolB translocation protein TolB; Provisional 99.28
KOG2106626 consensus Uncharacterized conserved protein, conta 99.28
KOG1310 758 consensus WD40 repeat protein [General function pr 99.26
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.26
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.23
KOG0649325 consensus WD40 repeat protein [General function pr 99.23
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.22
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.21
KOG2055514 consensus WD40 repeat protein [General function pr 99.21
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.2
KOG2111346 consensus Uncharacterized conserved protein, conta 99.19
KOG1188376 consensus WD40 repeat protein [General function pr 99.18
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.15
PRK01742429 tolB translocation protein TolB; Provisional 99.15
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.14
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.13
KOG2111346 consensus Uncharacterized conserved protein, conta 99.13
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.12
KOG1334559 consensus WD40 repeat protein [General function pr 99.12
KOG1963 792 consensus WD40 repeat protein [General function pr 99.1
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.1
KOG2139445 consensus WD40 repeat protein [General function pr 99.09
PRK05137435 tolB translocation protein TolB; Provisional 99.08
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.07
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.07
PRK11028330 6-phosphogluconolactonase; Provisional 99.05
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.05
KOG0771398 consensus Prolactin regulatory element-binding pro 99.05
PRK04922433 tolB translocation protein TolB; Provisional 99.05
PRK03629429 tolB translocation protein TolB; Provisional 99.03
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.03
PRK04922433 tolB translocation protein TolB; Provisional 99.03
PRK11028330 6-phosphogluconolactonase; Provisional 99.03
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.02
KOG4227609 consensus WD40 repeat protein [General function pr 99.02
KOG4547 541 consensus WD40 repeat-containing protein [General 99.01
KOG4227 609 consensus WD40 repeat protein [General function pr 99.0
PRK02889427 tolB translocation protein TolB; Provisional 98.99
PRK03629429 tolB translocation protein TolB; Provisional 98.99
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.96
PRK05137435 tolB translocation protein TolB; Provisional 98.96
KOG2139445 consensus WD40 repeat protein [General function pr 98.96
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.95
KOG2321 703 consensus WD40 repeat protein [General function pr 98.95
KOG4547541 consensus WD40 repeat-containing protein [General 98.95
PRK02889427 tolB translocation protein TolB; Provisional 98.91
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.91
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 98.91
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.89
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.88
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.86
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.86
KOG1310 758 consensus WD40 repeat protein [General function pr 98.85
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.84
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.82
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.82
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.81
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.81
PRK00178430 tolB translocation protein TolB; Provisional 98.76
PRK00178430 tolB translocation protein TolB; Provisional 98.75
KOG1963 792 consensus WD40 repeat protein [General function pr 98.74
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.73
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.72
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.69
PRK04792448 tolB translocation protein TolB; Provisional 98.68
PRK01029428 tolB translocation protein TolB; Provisional 98.65
PRK04792448 tolB translocation protein TolB; Provisional 98.61
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.6
KOG2321 703 consensus WD40 repeat protein [General function pr 98.6
PRK01029428 tolB translocation protein TolB; Provisional 98.58
KOG2315566 consensus Predicted translation initiation factor 98.57
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.55
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.52
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.5
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.49
COG4946668 Uncharacterized protein related to the periplasmic 98.45
KOG1334559 consensus WD40 repeat protein [General function pr 98.44
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.44
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.42
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.37
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.36
COG4946668 Uncharacterized protein related to the periplasmic 98.31
KOG2695425 consensus WD40 repeat protein [General function pr 98.25
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.22
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.2
KOG1409404 consensus Uncharacterized conserved protein, conta 98.19
KOG1409404 consensus Uncharacterized conserved protein, conta 98.14
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.13
KOG2695425 consensus WD40 repeat protein [General function pr 98.12
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.12
PRK04043419 tolB translocation protein TolB; Provisional 98.1
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.1
KOG2315566 consensus Predicted translation initiation factor 98.1
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.09
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.07
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.02
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.0
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.99
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.95
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.91
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.89
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.87
PRK04043419 tolB translocation protein TolB; Provisional 97.83
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.79
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.79
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.77
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.77
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.68
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.67
KOG2314698 consensus Translation initiation factor 3, subunit 97.64
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.64
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.64
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.62
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.59
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.59
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.56
KOG2314698 consensus Translation initiation factor 3, subunit 97.55
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.54
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.52
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.44
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.38
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.35
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.34
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.29
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.21
KOG3621 726 consensus WD40 repeat-containing protein [General 97.17
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.17
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.13
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.13
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.08
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.0
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.95
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.94
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.87
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.84
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.83
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.82
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.77
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.77
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.74
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.64
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.59
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.57
PRK02888635 nitrous-oxide reductase; Validated 96.4
KOG1912 1062 consensus WD40 repeat protein [General function pr 96.24
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.17
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.17
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.07
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.88
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 95.87
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.8
PRK00969 508 hypothetical protein; Provisional 95.78
KOG1008 783 consensus Uncharacterized conserved protein, conta 95.73
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.68
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.66
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.6
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.53
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.52
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.38
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.2
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 95.13
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.12
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.02
COG3391381 Uncharacterized conserved protein [Function unknow 95.0
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.98
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.91
KOG2395644 consensus Protein involved in vacuole import and d 94.9
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.83
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.68
PRK02888635 nitrous-oxide reductase; Validated 94.63
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.57
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.44
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.19
KOG2444238 consensus WD40 repeat protein [General function pr 94.17
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.06
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 93.86
KOG1008 783 consensus Uncharacterized conserved protein, conta 93.8
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.74
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 93.6
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.59
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.54
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.54
PRK13616591 lipoprotein LpqB; Provisional 93.31
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.21
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.77
PRK00969 508 hypothetical protein; Provisional 92.73
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 92.69
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 92.59
PRK13616591 lipoprotein LpqB; Provisional 92.5
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 92.5
COG3391381 Uncharacterized conserved protein [Function unknow 92.47
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.3
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 92.15
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 92.04
KOG2444238 consensus WD40 repeat protein [General function pr 91.9
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.44
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.31
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 91.26
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 91.08
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 90.69
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 90.68
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 90.12
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 89.98
KOG3621 726 consensus WD40 repeat-containing protein [General 89.65
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 89.14
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 89.14
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 89.13
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 88.93
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 88.85
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 88.58
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 88.4
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 87.86
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.77
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 87.55
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 87.53
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.27
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 87.19
KOG18971096 consensus Damage-specific DNA binding complex, sub 86.86
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 86.84
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 86.78
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 86.7
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 86.43
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.3
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 85.81
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 85.58
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 85.03
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 84.5
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 84.45
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 84.09
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 83.76
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 83.44
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 82.7
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 82.68
COG5167776 VID27 Protein involved in vacuole import and degra 82.64
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 82.63
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 82.32
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 82.12
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 82.06
KOG0883518 consensus Cyclophilin type, U box-containing pepti 82.0
COG3823262 Glutamine cyclotransferase [Posttranslational modi 81.85
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 81.55
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 81.39
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 81.33
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 80.63
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-98  Score=716.20  Aligned_cols=469  Identities=57%  Similarity=0.915  Sum_probs=435.5

Q ss_pred             CceeeecCCCCCeEEEEEeCCCCcceEEEEeCCCCeEEEEEcCCCCCcceEEEecCCCCeEEEEEcCCCCEEEEEeCCCc
Q 011473            1 MMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGI   80 (485)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~vs~s~d~~I~iwd~~~~~~~~~~~l~~h~~~V~~l~fspd~~~l~s~s~dg~   80 (485)
                      |++|+++.|.|..++|++..+++...++|+.-+++.|.|+|-..+..+....-+-|.+||.++.++|.++.++|.+..|+
T Consensus        88 minmiKL~~lPg~a~wv~skGd~~s~IAVs~~~sg~i~VvD~~~d~~q~~~fkklH~sPV~~i~y~qa~Ds~vSiD~~gm  167 (558)
T KOG0882|consen   88 MINMIKLVDLPGFAEWVTSKGDKISLIAVSLFKSGKIFVVDGFGDFCQDGYFKKLHFSPVKKIRYNQAGDSAVSIDISGM  167 (558)
T ss_pred             hhhhcccccCCCceEEecCCCCeeeeEEeecccCCCcEEECCcCCcCccceecccccCceEEEEeeccccceeeccccce
Confidence            78999999999999999999999999999999999999999874333444444579999999999999999999999999


Q ss_pred             EEEEcCC-CCCCCCceeEEEEcCCCceEEeecCCccEEEEEEcCCCCEEEEEeCCCcEEEEECCCCcEEEEeccchhHHH
Q 011473           81 IEYWSPH-TLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQ  159 (485)
Q Consensus        81 i~~Wd~~-t~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~i~~spdg~~lat~s~D~~I~iwd~~tg~~~~~~~~~~~~i~  159 (485)
                      |+.|..+ ++++|+..+-|.+|.++.|+.+.+.+....++.|||+|..+++-+.|++||++++++|++++.++|......
T Consensus       168 VEyWs~e~~~qfPr~~l~~~~K~eTdLy~f~K~Kt~pts~Efsp~g~qistl~~DrkVR~F~~KtGklvqeiDE~~t~~~  247 (558)
T KOG0882|consen  168 VEYWSAEGPFQFPRTNLNFELKHETDLYGFPKAKTEPTSFEFSPDGAQISTLNPDRKVRGFVFKTGKLVQEIDEVLTDAQ  247 (558)
T ss_pred             eEeecCCCcccCccccccccccccchhhcccccccCccceEEccccCcccccCcccEEEEEEeccchhhhhhhccchhhh
Confidence            9999877 799999989999999999999999999999999999999999999999999999999999999999887766


Q ss_pred             hhhcCCCcccccccccccchhhhhHhhhccCCCCCceEEECCCCCEEEEecCCCeEEEEcccCeEEEeecccCCccceee
Q 011473          160 DLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLR  239 (485)
Q Consensus       160 ~~~~~~~~~~~~~~~~~g~~~~~~~~i~~~~~~~~~~i~fd~~g~~l~~~s~~~i~v~d~~tg~~v~~~~~~~~~~r~~~  239 (485)
                      ..+.+   .|.+..+++|||+|+|+++.++.......++||++|+||+|++.-|||++++.|++++|++|+.| ++||++
T Consensus       248 ~q~ks---~y~l~~VelgRRmaverelek~~~~~~~~~~fdes~~flly~t~~gikvin~~tn~v~ri~gk~e-~ir~~~  323 (558)
T KOG0882|consen  248 YQPKS---PYGLMHVELGRRMAVERELEKHGSTVGTNAVFDESGNFLLYGTILGIKVINLDTNTVVRILGKDE-AIRFTR  323 (558)
T ss_pred             hcccc---ccccceeehhhhhhHHhhHhhhcCcccceeEEcCCCCEEEeecceeEEEEEeecCeEEEEeccch-hhhhhh
Confidence            66655   56888999999999999999999888899999999999999999999999999999999999999 899999


Q ss_pred             eeeccCCccCcceeeeeccccccccCCCCCCCCeEEEeeecCceEEEEecCCCCCCCccCCCccccCCCCCccccccccc
Q 011473          240 IALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSD  319 (485)
Q Consensus       240 ~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~l~~s~~~d~~i~~f~~~~~~~~~~~~~~rd~~n~~p~~e~~~~~~~  319 (485)
                      +||||+...++.. +.++.+++|+.+. ..+||+++|||.+++|||+|  ++|+.++   +.||+|||+|.+++.+.+.+
T Consensus       324 ~sl~q~~~k~~~~-~~~~~a~~np~~~-~~~dpt~~c~a~kk~rfylf--~ep~~~~---~~~dvfne~p~~~~~~~~~~  396 (558)
T KOG0882|consen  324 LSLYQGAQKSNLA-ALEVAASNNPLLE-FQKDPTIVCTAFKKNRFYLF--REPEFTE---SDRDVFNEKPLKEELMEARQ  396 (558)
T ss_pred             HHHHhhhhhccch-hhhhhhccCcccc-cCCCCeEEEeeeecceEEEE--ecCCCCc---chhhhhccCcChhHhhhhhh
Confidence            9999987555443 3388888886555 66999999999999999999  7777665   56899999999999999885


Q ss_pred             CCCCccCCCCCEEEEEeCCeEEEEEecCCCChHHHHHHHHhhhcCccCCceEEEEEeCcEEEecCCCCCCCCCcccCCCc
Q 011473          320 IGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGRE  399 (485)
Q Consensus       320 ~~~~~~~~~~~~~~~~t~~G~i~i~L~~~~aP~~~~nF~~l~~~~~y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~  399 (485)
                      ..  .....+..+++||++|+|.|.||+++||+||+||..+|++|||||..||||++|||||+|||.|+|+||+++||..
T Consensus       397 ~~--g~~~l~~~aiihtt~gdi~~kl~p~ecpktvenf~th~rngyy~~~~fhriik~fmiqtgdp~g~gtggesiwg~d  474 (558)
T KOG0882|consen  397 EE--GNKLLGKAAIIHTTQGDIHIKLYPEECPKTVENFTTHSRNGYYDNHTFHRIIKGFMIQTGDPLGDGTGGESIWGKD  474 (558)
T ss_pred             cc--CceecccceEEEecccceEEEecccccchhhhhhhccccCccccCcchHHhhhhheeecCCCCCCCCCCccccccc
Confidence            43  5667889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCCCceEEEEcccCCCCCCceEEEEccCCCCCCCCCcEEEEEEcCHHHHHHHhcCCCCCCCCcccCeEEEE
Q 011473          400 FEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILN  479 (485)
Q Consensus       400 ~~~e~~~~~~~~~~g~v~~~~~~~~~~~sqf~i~~~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~~~~~p~~~i~I~~  479 (485)
                      |+||+++.|+|++|++|||||.|||+||||||||+.+.||||++|||||||+.||+|+++|+++.+++++||+++++|.+
T Consensus       475 fedefh~~lrhdrpft~smanag~ntngsqffit~~~tpwld~khtvfgrv~~gm~vvqri~~v~t~k~drp~e~v~iin  554 (558)
T KOG0882|consen  475 FEDEFHPNLRHDRPFTVSMANAGPNTNGSQFFITTVPTPWLDGKHTVFGRVTAGMDVVQRIEQVKTDKYDRPYEDVKIIN  554 (558)
T ss_pred             chhhcCcccccCCCceEEecccCCCCCCceEEEEecCccccCCcceeEEEEecchhHHhHhhhcccCcCCCCCCceeEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEE
Q 011473          480 VTV  482 (485)
Q Consensus       480 ~~v  482 (485)
                      ++|
T Consensus       555 isv  557 (558)
T KOG0882|consen  555 ISV  557 (558)
T ss_pred             Eec
Confidence            987

>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 6e-67
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 3e-60
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 6e-43
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 6e-43
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-42
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 2e-42
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-42
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 7e-38
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 8e-37
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 2e-36
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 2e-36
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 2e-36
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 3e-36
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 9e-36
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 1e-35
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 2e-35
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-35
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 8e-35
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-34
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-34
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 4e-34
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 4e-34
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 5e-34
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 5e-34
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 7e-34
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 8e-34
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-33
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 6e-33
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 6e-33
1dyw_A173 Biochemical And Structural Characterization Of A Di 7e-33
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 9e-33
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 1e-32
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 2e-32
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 7e-32
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 1e-31
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 4e-31
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 4e-31
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 5e-31
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 5e-31
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 5e-31
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 5e-31
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 1e-30
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 1e-30
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 1e-30
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 1e-30
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-30
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 1e-30
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 2e-30
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-30
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 2e-30
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-30
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-30
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-30
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 2e-30
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 2e-30
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-30
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 3e-30
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 5e-30
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 1e-29
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-29
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 2e-28
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 3e-28
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 4e-28
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 6e-27
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 8e-26
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 6e-24
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 8e-22
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 6e-21
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 2e-19
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 1e-18
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 8e-17
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 9e-17
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 4e-15
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 3e-14
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure 
Iteration: 1

 Score =  251 bits (641), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 136/175 (77%), Gaps = 3/175 (1%)
Query: 309 PPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNN 368
           P  +E++A +        S  D+ I+HT+MGDIH KL+P ECPKTVENF  H RN YYN 
Sbjct: 3   PSKEEVMAATQAEGPKRVS--DSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNG 60
Query: 369 LIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGS 428
             FHR+IKGFMIQTGDP G G GG+SIWG EFEDEFH +LRHDRP+T+SMANAG NTNGS
Sbjct: 61  HTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGS 120
Query: 429 QFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTD-KNDKPYQDVKILNVTV 482
           QFFIT V TPWLDNKHTVFGRV KGM+VVQ I  VK + K DKPY+DV I+N+TV
Sbjct: 121 QFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITV 175
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
2b71_A196 Cyclophilin-like protein; structural genomics, str 1e-113
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 1e-112
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-110
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-107
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-106
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 1e-104
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 1e-104
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-103
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-100
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 1e-100
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 1e-95
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 4e-94
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 5e-76
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 9e-76
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-75
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 3e-75
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 2e-72
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-71
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 3e-71
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-71
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 5e-71
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 8e-71
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 1e-70
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 8e-70
1z81_A229 Cyclophilin; structural genomics, structural genom 2e-69
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 4e-69
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-69
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-68
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-68
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 5e-68
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 9e-68
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-67
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 4e-67
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-66
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 3e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 5e-07
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 4e-05
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
 Score =  330 bits (848), Expect = e-113
 Identities = 79/191 (41%), Positives = 108/191 (56%), Gaps = 2/191 (1%)

Query: 292 PEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECP 351
            ++ E+ +   ++ +EK    E           T      + ++T +GD  ++LY    P
Sbjct: 3   SDDEEEESNAINVVSEKTKSLEEKIAYYKMKGHTER--GYITIYTNLGDFEVELYWYHSP 60

Query: 352 KTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHD 411
           KT  NF T C   +Y+N IFHRVI  F+IQ GDP G G GG+SI+G  FEDE +K L+H 
Sbjct: 61  KTCLNFYTLCEMGFYDNTIFHRVIPNFVIQGGDPTGTGKGGKSIYGEYFEDEINKELKHT 120

Query: 412 RPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKP 471
               +SM+N GPNTN SQFFIT    P LD KHT+F RV K M  ++ I  V+T   +KP
Sbjct: 121 GAGILSMSNNGPNTNSSQFFITLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKP 180

Query: 472 YQDVKILNVTV 482
             D+KIL  + 
Sbjct: 181 IFDLKILRTST 191
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.95
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.95
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.94
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.94
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.94
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.93
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.93
2pm7_B297 Protein transport protein SEC13, protein transport 99.93
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.93
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.93
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.93
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.92
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.92
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.92
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.92
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.92
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.91
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.91
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.91
3jrp_A379 Fusion protein of protein transport protein SEC13 99.91
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.91
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.91
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.91
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.91
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.91
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.91
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.9
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.9
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.9
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.9
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.9
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.9
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.9
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.9
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.9
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.9
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.9
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.9
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.9
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.89
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
3jrp_A379 Fusion protein of protein transport protein SEC13 99.89
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.89
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.88
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.88
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.88
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.88
3jro_A 753 Fusion protein of protein transport protein SEC13 99.88
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.88
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.88
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.88
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.88
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.88
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.87
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.87
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.87
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.87
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.86
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.86
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.86
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.86
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.86
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
3jro_A 753 Fusion protein of protein transport protein SEC13 99.85
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.85
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.85
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.85
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.84
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.83
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.82
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.81
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.81
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.81
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.81
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.81
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.79
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.78
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.76
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.74
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.72
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.72
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.71
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.65
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.64
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.62
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.62
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.6
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.59
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.59
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.58
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.56
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.56
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.56
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.55
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.54
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.53
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.52
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.52
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.51
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.5
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.49
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.48
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.47
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.46
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.45
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.41
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.4
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.39
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.39
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.37
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.37
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.33
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.32
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.28
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.27
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.27
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.27
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.25
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.23
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.22
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.18
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.17
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.15
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.15
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.14
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.1
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.04
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.03
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.02
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.01
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.0
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.98
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.98
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.97
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.94
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.93
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.93
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.92
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.92
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.9
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.88
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.83
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.82
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.82
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.8
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.73
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.67
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.65
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.63
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.61
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.59
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.55
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.55
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.49
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.47
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.44
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.42
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.4
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.4
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.39
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.37
2qe8_A343 Uncharacterized protein; structural genomics, join 98.34
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.34
2qe8_A343 Uncharacterized protein; structural genomics, join 98.29
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.25
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.24
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.22
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.21
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.19
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.15
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.12
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.11
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.02
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.01
2ece_A462 462AA long hypothetical selenium-binding protein; 98.01
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.94
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.93
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.88
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.83
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.83
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.81
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.78
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.77
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.76
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.71
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.63
2ece_A462 462AA long hypothetical selenium-binding protein; 97.62
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.61
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.6
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.56
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.52
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.42
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.41
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.4
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.33
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.32
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.22
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.2
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.16
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.15
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.11
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.09
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.99
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.98
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.97
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.93
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.93
3v65_B386 Low-density lipoprotein receptor-related protein; 96.91
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.7
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.69
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.67
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.67
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.63
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.43
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.31
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.3
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.2
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.95
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.9
3v65_B386 Low-density lipoprotein receptor-related protein; 95.8
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.74
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.72
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.71
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.6
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.55
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.49
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.48
3kya_A496 Putative phosphatase; structural genomics, joint c 95.27
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.26
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 94.8
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.63
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 94.36
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.31
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.08
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 93.93
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.92
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 93.59
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.55
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 93.52
3kop_A188 Uncharacterized protein; protein with A cyclophili 92.76
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.55
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 92.52
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.07
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 91.94
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 91.49
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 91.29
3kya_A496 Putative phosphatase; structural genomics, joint c 90.59
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.71
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 89.71
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.45
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.45
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 89.44
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 88.82
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 88.76
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 88.74
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 87.82
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 86.42
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 85.33
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 84.12
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 83.19
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 83.0
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 82.58
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 81.5
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=2.3e-49  Score=352.82  Aligned_cols=174  Identities=67%  Similarity=1.154  Sum_probs=155.6

Q ss_pred             CCCcccccccccCCCCccCCCCCEEEEEeCCeEEEEEecCCCChHHHHHHHHhhhcCccCCceEEEEEeCcEEEecCCCC
Q 011473          308 KPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLG  387 (485)
Q Consensus       308 ~p~~e~~~~~~~~~~~~~~~~~~~~~~~t~~G~i~i~L~~~~aP~~~~nF~~l~~~~~y~g~~f~rv~~~~~iq~G~~~~  387 (485)
                      +|++|++.+++  ..+.+......|+++|+.|+|+||||++.||+||+||++||+.+||+|+.||||+|+|||||||+.+
T Consensus         2 ~~~~~~~~~~~--~~~~~~~~~~~v~~~t~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~FhRvi~~f~iQgGd~~~   79 (176)
T 2a2n_A            2 SPSKEEVMAAT--QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTG   79 (176)
T ss_dssp             -------------CCCSCCCCCSEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTS
T ss_pred             Ccchhhhhhcc--cCCCCCCCCCEEEEEecCccEEEEEeCCCChHHHHHHHHHhhcCccCCCEEEEEECCcEEEccCCCC
Confidence            46777777765  4555667788999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcccCCCccccccccCCCCCCceEEEEcccCCCCCCceEEEEccCCCCCCCCCcEEEEEEcCHHHHHHHhcCCCC-
Q 011473          388 DGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTD-  466 (485)
Q Consensus       388 ~~~~~~~~~~~~~~~e~~~~~~~~~~g~v~~~~~~~~~~~sqf~i~~~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~-  466 (485)
                      +|.|++++||..|++|+...++|+++|+||||+.+|++++|||||++.++|+||++|+|||||++|||||++|++++++ 
T Consensus        80 ~g~gg~si~g~~~~dE~~~~l~h~~~G~lsmA~~gp~s~gSQFFIt~~~~~~LDg~~tVFG~Vv~Gmdvv~~I~~~~t~~  159 (176)
T 2a2n_A           80 TGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNP  159 (176)
T ss_dssp             SSSCCCCTTSSCBCCCCCTTCCSCSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCT
T ss_pred             CCCCCCcccCCccccccccccccCCceEEEEEeCCCCCcccEEEEECCCCCccCCCeeEEEEEeCCHHHHHHHHcCCccC
Confidence            9999999999999999977899999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCCCcccCeEEEEEEEc
Q 011473          467 KNDKPYQDVKILNVTVP  483 (485)
Q Consensus       467 ~~~~p~~~i~I~~~~v~  483 (485)
                      ++++|.++|+|.+|+|.
T Consensus       160 ~~~~P~~~v~I~~v~v~  176 (176)
T 2a2n_A          160 KTDKPYEDVSIINITVK  176 (176)
T ss_dssp             TTCCBSSCCBEEEEEEC
T ss_pred             CCCccCCCeEEEEEEEC
Confidence            68999999999999874
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 5e-58
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 6e-57
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 8e-53
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-52
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 7e-50
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 2e-47
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 2e-47
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-46
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 6e-46
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 4e-45
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 2e-44
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 7e-44
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 8e-44
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 2e-43
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-43
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 5e-41
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 1e-40
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-40
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 8e-40
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 2e-38
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 5e-36
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-35
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.003
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  187 bits (475), Expect = 5e-58
 Identities = 79/154 (51%), Positives = 102/154 (66%)

Query: 329 PDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGD 388
           P NV L T+MG I ++LY +  PKT +NF    R  YYN   FHR+IK FMIQ GDP G 
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 389 GTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFG 448
           G GG SI+G++FEDE H  L+      ++MANAGP+TNGSQFF+T   T WLD KHT+FG
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFG 130

Query: 449 RVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTV 482
           RV +G+ +V  +  V+T+  D+P  DVKI+    
Sbjct: 131 RVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYP 164
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.92
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.92
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.91
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.89
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.89
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.89
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.89
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.87
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.87
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.85
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.83
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.82
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.82
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.79
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.78
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.77
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.74
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.73
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.71
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.7
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.68
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.65
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.65
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.6
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.55
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.53
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.5
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.37
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.37
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.37
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.31
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.28
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.15
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.07
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.01
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.99
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.92
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.64
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.45
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.43
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.32
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.11
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.1
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.05
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.88
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.86
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.78
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.77
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.77
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.76
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.62
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.4
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.24
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.22
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.95
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.94
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.6
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.97
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.21
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.34
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.31
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.64
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 91.93
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 91.12
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.58
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.18
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.51
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 88.47
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 86.9
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 85.58
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 85.5
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 85.06
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 84.25
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.24
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.18
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 82.71
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.08
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 80.63
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 80.57
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Putative cyclophilin PFE0505w
species: Plasmodium falciparum [TaxId: 5833]

Probab=100.00  E-value=1.9e-43  Score=310.20  Aligned_cols=153  Identities=67%  Similarity=1.143  Sum_probs=148.8

Q ss_pred             CEEEEEeCCeEEEEEecCCCChHHHHHHHHhhhcCccCCceEEEEEeCcEEEecCCCCCCCCCcccCCCccccccccCCC
Q 011473          330 DNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLR  409 (485)
Q Consensus       330 ~~~~~~t~~G~i~i~L~~~~aP~~~~nF~~l~~~~~y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~e~~~~~~  409 (485)
                      .+++|+|+.|+|+||||++.||++|+||++||+++||+|+.|||+++++++|+|++.+.+.++.+.++..+++|....++
T Consensus         2 ~~~~i~T~~G~i~ieL~~~~aP~tv~nF~~l~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~~~   81 (155)
T d2fu0a1           2 KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLN   81 (155)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTBC
T ss_pred             ceEEEEEcccEEEEEEcCCCChHHHHHHhhHhhCCccccceeeeeeecceeeccCCCCCCcCCcccCCCccccccccccc
Confidence            57899999999999999999999999999999999999999999999999999999988888899999999999988999


Q ss_pred             CCCceEEEEcccCCCCCCceEEEEccCCCCCCCCCcEEEEEEcCHHHHHHHhcCCCCCCCCcccCeEEEEEEE
Q 011473          410 HDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTV  482 (485)
Q Consensus       410 ~~~~g~v~~~~~~~~~~~sqf~i~~~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~~~~~p~~~i~I~~~~v  482 (485)
                      |.++|+++|++.++++++|||||++++.|+||++|+|||||++||++|++|++++++++++|+++|+|.+|+|
T Consensus        82 ~~~~~~~~~~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi~G~~vv~~I~~~~t~~~~~P~~~i~I~~v~i  154 (155)
T d2fu0a1          82 HSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI  154 (155)
T ss_dssp             SSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCTTSCBSSCCBEEEEEE
T ss_pred             cCCccEEEecccCCCCCCccceecccCccccccceEEEEEEeccHHHHHHHHhCCCCCCCCcCCCcEEEEEEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999987
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure