Citrus Sinensis ID: 011505


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----
MGRVTVVVVCCAALAAGVAAAVVVCRRVKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYIAAELAKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSINTGTLVGRDVVEELSRAMAKQGLDMSVSALVNDTVGTLAGGRYTNKDVVAAVILGTGSNAAYVERAQAIPKWHGVPSKSGEMVINMEWGDFRSSHLSLSEYDNALDAESLNPGEQIFEKMISGMYLGEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILEISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRDAAKDGDKQKTVIAMDGGLYEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKYLQDE
cccEEEEHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccEEEEEEEEEccccEEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHcccccEEEEEECcccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccHHcHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccEEHccHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcHHccc
***VTVVVVCCAALAAGVAAAVVVCRRVKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYIAAELAKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSINTGTLVGRDVVEELSRAMAKQGLDMSVSALVNDTVGTLAGGRYTNKDVVAAVILGTGSNAAYVERAQAIPKWHGVPSKSGEMVINMEWGDFRSSHLSLSEYDNALDAESLNPGEQIFEKMISGMYLGEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILEISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRD****GDKQKTVIAMDGGLYEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKY****
xxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRVTVVVVCCAALAAGVAAAVVVCRRVKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYIAAELAKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSINTGTLVGRDVVEELSRAMAKQGLDMSVSALVNDTVGTLAGGRYTNKDVVAAVILGTGSNAAYVERAQAIPKWHGVPSKSGEMVINMEWGDFRSSHLSLSEYDNALDAESLNPGEQIFEKMISGMYLGEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILEISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRDAAKDGDKQKTVIAMDGGLYEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKYLQDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hexokinase-2 Fructose and glucose phosphorylating enzyme. May be involved in the phosphorylation of glucose during the export from mitochondrion to cytosol. Acts as sugar sensor which may regulate sugar-dependent gene repression or activation. Mediates the effects of sugar on plant growth and development independently of its catalytic activity or the sugar metabolism. May regulate the execution of program cell death in plant cells.probableP93834
Hexokinase-6 Fructose and glucose phosphorylating enzyme. May be involved in the phosphorylation of glucose during the export from plastids to cytosol.probableQ8LQ68
Hexokinase-2 Fructose and glucose phosphorylating enzyme. May be involved in the phosphorylation of glucose during the export from plastids to cytosol. Seems neither to be involved in cell sugar sensing nor in carbohydrate metabolism in tuber.probableQ9SQ76

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.1Hexokinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CZA, chain N
Confidence level:very confident
Coverage over the Query: 35-480
View the alignment between query and template
View the model in PyMOL