Citrus Sinensis ID: 011550

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MALAASSICLYGNERIGNPCSRTGFAITEKSQNRRMVYYRGIVTLKIKSNGKKSTCSQLMRSYRNCCKIGLRCSNLVSGRREKVSSISNTGTTIPEAKEVLKNLVHPVPNVLKEWSQLQLINVAGVLACMFLVIPSAGAVDALKTCTCLLRECRLELAECISNPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPQKSDLGEFPVPDPAILVKSFNIKDFNGKWYISSGLNPSFDTFDCQLHEFHTESNKLIGNLSWRIRTPDGGFFTRSAMQRFFQDPIHPGILYNHDNEYLHYKDDWYILSSKIQNEPDDYVFVYYRGSNDAWDGYGGAFLYTRSKTVPETIVPELERAAKSVGRDFNKFIRTDNTCGPEPPLVERLEKKVEEGERTIIKEVEQLEGEVEKVGRTEMTLFQRLAEGFKELQKDEEKFLRELSKEEMDLLSELKMEASEVENLFGRALPVKKIR
cccccccEEECccccccccccccccccHHHHccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHcEEEEEEEccccccHHccHHHHHHHHHccHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccHHHccccccccccCEEEEECccccccccccccccEEEccccEEEEEEEEEEEccccccEECccEEEEEEccccccEEEEcccccccccccEEEEEcccccccccEEEEEEccccccccccccEEEEEcccccccccHHHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
******SICLYGNERIGNPCSRTGFAITEKSQNRRMVYYRGIVTLKIKSNGKKSTCSQLMRSYRNCCKIGLRCSNLVSGR**********GTTIPEAKEVLKNLVHPVPNVLKEWSQLQLINVAGVLACMFLVIPSAGAVDALKTCTCLLRECRLELAECISNPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPQKSDLGEFPVPDPAILVKSFNIKDFNGKWYISSGLNPSFDTFDCQLHEFHTESNKLIGNLSWRIRTPDGGFFTRSAMQRFFQDPIHPGILYNHDNEYLHYKDDWYILSSKIQNEPDDYVFVYYRGSNDAWDGYGGAFLYTRSKTVPETIVPELERAAKSVGRDFNKFIRTDNTCGPEPPL*****************************GRTEMTLFQRLAEGFKE***********************KMEASEVENLFGRALPVKKI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALAASSICLYGNERIGNPCSRTGFAITEKSQNRRMVYYRGIVTLKIKSNGKKSTCSQLMRSYRNCCKIGLRCSNLVSGRREKVSSISNTGTTIPEAKEVLKNLVHPVPNVLKEWSQLQLINVAGVLACMFLVIPSAGAVDALKTCTCLLRECRLELAECISNPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPQKSDLGEFPVPDPAILVKSFNIKDFNGKWYISSGLNPSFDTFDCQLHEFHTESNKLIGNLSWRIRTPDGGFFTRSAMQRFFQDPIHPGILYNHDNEYLHYKDDWYILSSKIQNEPDDYVFVYYRGSNDAWDGYGGAFLYTRSKTVPETIVPELERAAKSVGRDFNKFIRTDNTCGPEPPLxxxxxxxxxxxxxxxxxxxxxLEGEVEKVGRTEMTLFQRLAEGxxxxxxxxxxxxxxxxxxxxxLLSELKMEASEVENLFGRALPVKKIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Violaxanthin de-epoxidase, chloroplastic Part of the xanthophyll (or violaxanthin) cycle for controlling the concentration of zeaxanthin in chloroplasts. Catalyzes the two-step mono de-epoxidation reaction. Stereospecific for all-trans xanthophylls. Zeaxanthin induces the dissipation of excitation energy in the chlorophyll of the light-harvesting protein complex of photosystem II.confidentQ39249
Violaxanthin de-epoxidase, chloroplastic Part of the xanthophyll (or violaxanthin) cycle for controlling the concentration of zeaxanthin in chloroplasts. Catalyzes the two-step mono de-epoxidation reaction. Stereospecific for all-trans xanthophylls. Zeaxanthin induces the dissipation of excitation energy in the chlorophyll of the light-harvesting protein complex of photosystem II.probableQ40593
Violaxanthin de-epoxidase, chloroplastic Part of the xanthophyll (or violaxanthin) cycle for controlling the concentration of zeaxanthin in chloroplasts. Catalyzes the two-step mono de-epoxidation reaction. Stereospecific for all-trans xanthophylls. Zeaxanthin induces the dissipation of excitation energy in the chlorophyll of the light-harvesting protein complex of photosystem II.probableQ40251

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.10.-.-Acting on diphenols and related substances as donors.probable
1.10.99.-With other acceptors.probable
1.10.99.3Violaxanthin de-epoxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CQN, chain A
Confidence level:very confident
Coverage over the Query: 220-388
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 395-459
View the alignment between query and template
View the model in PyMOL