Citrus Sinensis ID: 011570


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MAFALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRITFDPDRIVMSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSSNDFKVTMEALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAATVFTKESSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARKMSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCPNPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVPNKKKLCWQRSLRLSMSSRRMDDFMASPCMSPQSPLVQART
ccccccccHHHHHHHHHcccccccccHHHHHHHHcccccccccccccEEEEccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHHHHHcccccEEEEccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccccccccccccccEEEEcccccccccccccEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccHHccccHHHHHHHHHHHHHHccEEECcccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccHHHHccccEEECcccccccccccccccccccccccccc
**********************EDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRITFDPDRIVMSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSSNDFKVTMEALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAATVFTKESSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARKMSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCPNPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVPNKKKLCWQRS******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRITFDPDRIVMSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSxxxxxxxxxxxxxxxxxxxxxNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAATVFTKESSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARKMSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCPNPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVPNKKKLCWQRSLRLSMSSRRMDDFMASPCMSPQSPLVQART

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-aminocyclopropane-1-carboxylate synthase Catalyzes the formation of 1-aminocyclopropane-1-carboxylate, a direct precursor of ethylene in higher plants.confidentP31531
1-aminocyclopropane-1-carboxylate synthase 6 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1-aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene. Involved in bacterial flagellin-induced ethylene production.probableQ9SAR0
1-aminocyclopropane-1-carboxylate synthase 2 Catalyzes the formation of 1-aminocyclopropane-1-carboxylate, a direct precursor of ethylene in higher plants.probableQ00379

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.4.-.-Carbon-sulfur lyases.probable
4.4.1.-Carbon-sulfur lyases.probable
4.4.1.141-aminocyclopropane-1-carboxylate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PIU, chain A
Confidence level:very confident
Coverage over the Query: 26-438
View the alignment between query and template
View the model in PyMOL