Citrus Sinensis ID: 011596

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MENPNWSMVELEAPSEEDFLRAEHHTAAPANKTRNRNAKQLTWVLLLKAHKAAGCLTSIASAFFSLGSLVRRRVAAGRTDQPPTSADTHEIQKLRTRFFYSCIKLFLWLSVVLFAFELCAYFKGWHFATPNLQLQYIFQSPLAIKGAFDLLYSSWVLVRVHYLAPPLQFLANACIVLFLIQSLDRLILCLGCFWIRFKRIKPVPKHDDTSDLESGQKGFFPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKSKILIQVLDDSDDPTAQTLIKEEVLKWQEAGANIVYRHRILRDGYKAGNLKSAMNCSYVKDYEFVAIFDADFQPNPDFLRRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQDINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRAKVYILSNTSCL
cccccEEEEEEccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHccccccccCEEEEEEccccccHHHHHHHHHHHcccccEEEEEEccEEccccccHHHHHHHHHHccccEEEEEcccccccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccc
***PNWSMVELEAPSEED********************KQLTWVLLLKAHKAAGCLTSIASAFFSLGSLVRRRVAAG***************KLRTRFFYSCIKLFLWLSVVLFAFELCAYFKGWHFATPNLQLQYIFQSPLAIKGAFDLLYSSWVLVRVHYLAPPLQFLANACIVLFLIQSLDRLILCLGCFWIRFKRIKPV*********ESGQKGFFPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKSKILIQVLDDSDDPTAQTLIKEEVLKWQEAGANIVYRHRILRDGYKAGNLKSAMNCSYVKDYEFVAIFDADFQPNPDFLRRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQDINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRAKVYILSNTSCL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENPNWSMVELEAPSEEDFLRAEHHTAAPANKTRNRNAKQLTWVLLLKAHKAAGCLTSIASAFFSLGSLVRRRVAAGRTDQPPTSADTHEIQKLRTRFFYSCIKLFLWLSVVLFAFELCAYFKGWHFATPNLQLQYIFQSPLAIKGAFDLLYSSWVLVRVHYLAPPLQFLANACIVLFLIQSLDRLILCLGCFWIRFKRIKPVPKHDDTSDLESGQKGFFPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKSKILIQVLDDSDDPTAQTLIKEEVLKWQEAGANIVYRHRILRDGYKAGNLKSAMNCSYVKDYEFVAIFDADFQPNPDFLRRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQDINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRAKVYILSNTSCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable xyloglucan glycosyltransferase 12 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.probableQ9ZQB9
Probable xyloglucan glycosyltransferase 9 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.probableQ6AU53
Putative xyloglucan glycosyltransferase 10 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.probableQ84Z01

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HG6, chain A
Confidence level:very confident
Coverage over the Query: 140-479
View the alignment between query and template
View the model in PyMOL