Citrus Sinensis ID: 011638

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MAGVTAAKNQHQVFDVSLPESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHEEEEEEEEEEEEEcccccccccccCECcccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEEEHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
**************************D*DGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVTAAKNQHQVFDVSLPESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amino acid permease 3 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for GABA, tryptophan and both neutral and basic amino acids. High affinity transport of cationic amino acids.confidentQ39134
Amino acid permease 4 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine.probableQ9FN04
Amino acid permease 2 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for histidine, arginine, glutamate and neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine. Has a much higher affinity for basic amino acids as compared with AAP1. May function in xylem-to-phloem transfer and in uptake of amino acids assimilated in the green silique tissue.probableQ38967

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 33-226,241-436
View the alignment between query and template
View the model in PyMOL